KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100595917Help
Entry
100595917         CDS       T03265                                 

Gene name
HK1
Definition
(RefSeq) hexokinase 1
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle00010  Glycolysis / Gluconeogenesis
nle00051  Fructose and mannose metabolism
nle00052  Galactose metabolism
nle00500  Starch and sucrose metabolism
nle00520  Amino sugar and nucleotide sugar metabolism
nle00524  Neomycin, kanamycin and gentamicin biosynthesis
nle01100  Metabolic pathways
nle01200  Carbon metabolism
nle04066  HIF-1 signaling pathway
nle04910  Insulin signaling pathway
nle04930  Type II diabetes mellitus
nle04973  Carbohydrate digestion and absorption
nle05230  Central carbon metabolism in cancer
Module
nle_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
nle_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:nle00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100595917 (HK1)
   00051 Fructose and mannose metabolism
    100595917 (HK1)
   00052 Galactose metabolism
    100595917 (HK1)
   00500 Starch and sucrose metabolism
    100595917 (HK1)
   00520 Amino sugar and nucleotide sugar metabolism
    100595917 (HK1)
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    100595917 (HK1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    100595917 (HK1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100595917 (HK1)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    100595917 (HK1)
 09160 Human Diseases
  09161 Cancers
   05230 Central carbon metabolism in cancer
    100595917 (HK1)
  09166 Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    100595917 (HK1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:nle04131]
    100595917 (HK1)
Enzymes [BR:nle01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     100595917 (HK1)
Membrane trafficking [BR:nle04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    100595917 (HK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 CSD
Motif
Other DBs
NCBI-GeneID: 100595917
NCBI-ProteinID: XP_012352448
LinkDB All DBs
Position
18
AA seq 898 aa AA seqDB search
MGQICQRESATATEKPKLHLLAESEIDKYLYAMRLSDETLIDIMTRFRKEMKNGLSRDFN
PTAIVKMLPTFVRSIPDGSEKGDFIALDLGGSSFRILRVQVNHEKNQNVHMESEVYDTPE
NIVHGSGSQAAFFWVPESSMAVSLPCAILITWTKRFKASGVEGADVVKLLNKAIKKRGDY
DANIVAVVNDTVGTMMTCGYDDQQCEVGLIIGTGTNACYMEELRHIDLVEGDEGRMCINT
EWGAFGDDGSLEDIRTEFDREIDRGSLNPGKQLFEKMVSGMYLGELVRLILVKMAKEGLL
FEGRITPELLTRGKFNTSDVSAIEKNKEGLHNAKEILTRLGVEPSDDDCVSVQHVCTIVS
FRSANLVAATLGAILNRLRDNKGTPRLRTTVGVDGSLYKTHPQYSRRFHKTLRRLVPDSD
VRFLLSESGSGKGAAMVTAVAYRLAEQHRQIEETLAHFHLTKDMLLEVKKRMRAEMELGL
RKQTHNNAAVKMLPSFVRRTPDGTENGDFLALDLGGTNFRVLLVKIRSGKKRTVEMHNKI
YAIPIEIMQGTGEELFDHIVTCISDFLDYMGIKGPRMPLGFTFSFPCKQTSLDAGILITW
TKGFKATDCVGHDVATLLRDAIKRREEFDLDVVAVVNDTVGTMMTCAYEEPTCEVGLIVG
TGSNACYMEEMKNVEMVEGDQGQMCINMEWGAFGDNGCLDDIRTHYDRLVDEYSLNAGKQ
RYEKMISGMYLGEIVRNILIDFTKKGFLFRGQISEPLKTRGIFETKFLSQIESDRLALLQ
VRAILQQLGLNSTCDDSILVKTVCGVVSRRAAQLCGAGMAAVVDKIRENRGLDRLNVTVG
VDGTLYKLHPHFSRIMHQTVKELSPKCNVSFLLSEDGSGKGAALITAVGVRLRTEASS
NT seq 2697 nt NT seq  +upstreamnt  +downstreamnt
atggggcagatctgccagcgagaatcggctacagcaactgaaaaaccaaaacttcatcta
cttgctgaaagtgagattgacaagtatctctatgccatgcggctctccgatgaaactctc
atagatatcatgactcgcttcaggaaggagatgaagaatggcctctcccgggattttaat
ccaacagccatagtcaagatgttgccaacattcgtaaggtcaattcctgatggctctgaa
aagggagatttcattgccctggatcttggtgggtcttcctttcgaattctgcgggtgcaa
gtgaatcatgagaaaaaccagaatgttcacatggagtccgaggtttatgacaccccagag
aacatcgtgcacggcagtggaagccaggcagccttcttctgggttccagaaagctccatg
gctgtgtcactgccgtgtgccatcctgatcacctggacaaagcgatttaaagcgagcgga
gtggaaggagcagatgtggtcaagctgcttaacaaagccatcaaaaagcgaggggactat
gatgccaacatcgtagctgtggtgaatgacacagtgggcaccatgatgacctgtggctat
gacgaccagcagtgtgaagtcggcctgatcatcggcactggcaccaatgcttgctacatg
gaggaactgaggcacattgatctggtggaaggagacgaggggaggatgtgtatcaacact
gaatggggagcctttggagacgatggatcattagaagacatcaggacggagtttgacagg
gagatagaccggggatccctcaaccctggaaaacagctgtttgagaagatggtcagtggc
atgtacttgggagagctggttcgactgatcctagtcaagatggccaaggagggcctctta
tttgaagggcggatcaccccggagctgctcaccagagggaagtttaacaccagtgatgtg
tcagccatcgaaaagaataaggaaggcctccacaatgccaaagaaatcctgacccgcctg
ggagtggagccgtccgatgatgactgtgtctcggtccagcacgtttgcaccattgtctca
tttcgctcagccaacctggtggctgccacgctgggcgccatcttgaaccgcctgcgtgat
aacaagggcacaccgaggctgcggaccacggttggtgtcgacggatctctttacaagacg
cacccacagtattcccggcgtttccacaagactctgaggcgcttggtgccggactccgat
gtgcgcttcctcctctcggagagtggcagcggcaagggggctgccatggtgacggcggtg
gcctaccgcttggccgagcagcaccggcagatagaggagaccctggctcatttccacctc
accaaggacatgctgctggaggtgaagaagaggatgcgggccgagatggagctggggctg
aggaagcagacgcacaacaatgccgcggttaagatgctgccctccttcgtccggagaact
cccgacgggaccgagaatggtgacttcttggccctggatcttggaggaaccaatttccgt
gtgctgctggtgaaaatccgtagtgggaaaaagagaacggtggaaatgcacaacaagatc
tatgccattcctattgaaatcatgcagggcaccggggaagagctgtttgatcacattgtc
acctgcatctctgacttcctggactacatggggatcaaaggccccaggatgcctctgggc
ttcacgttctcatttccttgcaaacagacaagtctggacgcgggaatcttgatcacgtgg
acaaagggttttaaggcaacagactgcgtgggccacgatgtagccaccttactaagggat
gcaataaaaaggagagaggaatttgacttggacgtggtggctgtggtcaacgacacagtg
ggcaccatgatgacctgtgcttatgaggagcccacctgtgaggtcggactcattgttggg
accggcagcaatgcctgctacatggaggagatgaagaacgtggagatggtggagggggac
caggggcagatgtgcatcaacatggagtggggggcctttggggacaacgggtgtctggat
gatatcaggacacactacgacagactggtggacgaatattccctaaatgccgggaaacaa
aggtatgagaagatgatcagtggtatgtacctgggtgaaatcgtccgcaacatcttaatc
gacttcaccaagaagggattcctcttccgagggcagatctctgagccgctgaagacccgg
ggcatctttgagaccaagtttctctctcagatcgagagtgaccgattagcactgctccag
gtccgggctatcctccagcagctaggtctgaacagcacctgcgatgacagtatcctcgtc
aagacagtgtgcggggtggtgtctaggagggccgcgcagctgtgtggcgcaggcatggcc
gcggtggtggataagatccgcgagaacagaggactggaccgtctgaatgtgactgtggga
gtggacgggacgctctacaagcttcatccacacttctccagaatcatgcaccagacggtg
aaggaactgtcaccaaaatgtaacgtgtccttcctcctgtctgaggatggcagcggcaag
ggggctgccctcatcacggccgtgggcgtgcggttacgcacagaggcaagcagctaa

DBGET integrated database retrieval system