KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100599011
Entry
100599011         CDS       T03265                                 

Gene name
BCL2
Definition
(RefSeq) apoptosis regulator Bcl-2
  KO
K02161  apoptosis regulator Bcl-2
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle01521  EGFR tyrosine kinase inhibitor resistance
nle01522  Endocrine resistance
nle01524  Platinum drug resistance
nle04064  NF-kappa B signaling pathway
nle04066  HIF-1 signaling pathway
nle04071  Sphingolipid signaling pathway
nle04115  p53 signaling pathway
nle04140  Autophagy - animal
nle04141  Protein processing in endoplasmic reticulum
nle04151  PI3K-Akt signaling pathway
nle04210  Apoptosis
nle04215  Apoptosis - multiple species
nle04217  Necroptosis
nle04261  Adrenergic signaling in cardiomyocytes
nle04340  Hedgehog signaling pathway
nle04510  Focal adhesion
nle04621  NOD-like receptor signaling pathway
nle04630  JAK-STAT signaling pathway
nle04722  Neurotrophin signaling pathway
nle04725  Cholinergic synapse
nle04915  Estrogen signaling pathway
nle04928  Parathyroid hormone synthesis, secretion and action
nle04933  AGE-RAGE signaling pathway in diabetic complications
nle05014  Amyotrophic lateral sclerosis
nle05022  Pathways of neurodegeneration - multiple diseases
nle05132  Salmonella infection
nle05145  Toxoplasmosis
nle05152  Tuberculosis
nle05161  Hepatitis B
nle05162  Measles
nle05168  Herpes simplex virus 1 infection
nle05169  Epstein-Barr virus infection
nle05170  Human immunodeficiency virus 1 infection
nle05200  Pathways in cancer
nle05206  MicroRNAs in cancer
nle05210  Colorectal cancer
nle05215  Prostate cancer
nle05222  Small cell lung cancer
nle05226  Gastric cancer
nle05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:nle00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100599011 (BCL2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    100599011 (BCL2)
   04630 JAK-STAT signaling pathway
    100599011 (BCL2)
   04064 NF-kappa B signaling pathway
    100599011 (BCL2)
   04066 HIF-1 signaling pathway
    100599011 (BCL2)
   04071 Sphingolipid signaling pathway
    100599011 (BCL2)
   04151 PI3K-Akt signaling pathway
    100599011 (BCL2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100599011 (BCL2)
  09143 Cell growth and death
   04210 Apoptosis
    100599011 (BCL2)
   04215 Apoptosis - multiple species
    100599011 (BCL2)
   04217 Necroptosis
    100599011 (BCL2)
   04115 p53 signaling pathway
    100599011 (BCL2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100599011 (BCL2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100599011 (BCL2)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    100599011 (BCL2)
   04928 Parathyroid hormone synthesis, secretion and action
    100599011 (BCL2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100599011 (BCL2)
  09156 Nervous system
   04725 Cholinergic synapse
    100599011 (BCL2)
   04722 Neurotrophin signaling pathway
    100599011 (BCL2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100599011 (BCL2)
   05206 MicroRNAs in cancer
    100599011 (BCL2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100599011 (BCL2)
   05226 Gastric cancer
    100599011 (BCL2)
   05215 Prostate cancer
    100599011 (BCL2)
   05222 Small cell lung cancer
    100599011 (BCL2)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    100599011 (BCL2)
   05022 Pathways of neurodegeneration - multiple diseases
    100599011 (BCL2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100599011 (BCL2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100599011 (BCL2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100599011 (BCL2)
   05152 Tuberculosis
    100599011 (BCL2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100599011 (BCL2)
   05161 Hepatitis B
    100599011 (BCL2)
   05162 Measles
    100599011 (BCL2)
   05168 Herpes simplex virus 1 infection
    100599011 (BCL2)
   05169 Epstein-Barr virus infection
    100599011 (BCL2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100599011 (BCL2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100599011 (BCL2)
   01524 Platinum drug resistance
    100599011 (BCL2)
   01522 Endocrine resistance
    100599011 (BCL2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:nle01009]
    100599011 (BCL2)
Protein phosphatases and associated proteins [BR:nle01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100599011 (BCL2)
SSDB
Motif
Pfam: Bcl-2 BH4 Bcl-2_3
Other DBs
NCBI-GeneID: 100599011
NCBI-ProteinID: XP_003264347
Ensembl: ENSNLEG00000035984
UniProt: A0A2I3GZF9
LinkDB
Position
4
AA seq 239 aa
MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPA
ASRDPVARTSPLPTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLH
LTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEY
LNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK
NT seq 720 nt   +upstreamnt  +downstreamnt
atggcgcacgctgggagaacagggtacgataaccgggagatagtgatgaagtacatccat
tataagctgtcgcagaggggctacgagtgggatgcgggagatgtgggcgccgcgcccccg
ggggccgcccccgcaccgggcatcttctcctcccagccggggcacacgccccatccagct
gcatcccgggacccggtcgccaggacctcgccgctgccgaccccggctgcccccggcgcc
gccgcggggcctgcgctcagcccggtgccacctgtggtccacctgaccctccgccaggcc
ggcgatgacttctcccgccgctaccgccgcgacttcgccgagatgtccagccagctgcac
ctgacgcccttcaccgcgcggggacgctttgccacggtggtggaggagctcttcagggac
ggggtgaactgggggaggattgtggccttctttgagttcggtggggtcatgtgtgtggag
agcgtcaaccgggagatgtcgcccctggtggacaacatcgccctgtggatgactgagtac
ctgaaccggcacctgcacacctggatccaggataacggaggctgggatgcctttgtggaa
ctgtacggccccagcatgcggcctctgtttgatttctcctggctgtctctgaagactctg
ctcagtttggccctggtgggagcttgcatcaccctgggtgcctatctgggccacaagtga

DBGET integrated database retrieval system