KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100603768
Entry
100603768         CDS       T03265                                 

Gene name
IKBKG
Definition
(RefSeq) NF-kappa-B essential modulator isoform X1
  KO
K07210  inhibitor of nuclear factor kappa-B kinase subunit gamma
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle01523  Antifolate resistance
nle04010  MAPK signaling pathway
nle04014  Ras signaling pathway
nle04062  Chemokine signaling pathway
nle04064  NF-kappa B signaling pathway
nle04151  PI3K-Akt signaling pathway
nle04210  Apoptosis
nle04380  Osteoclast differentiation
nle04620  Toll-like receptor signaling pathway
nle04621  NOD-like receptor signaling pathway
nle04622  RIG-I-like receptor signaling pathway
nle04623  Cytosolic DNA-sensing pathway
nle04625  C-type lectin receptor signaling pathway
nle04657  IL-17 signaling pathway
nle04658  Th1 and Th2 cell differentiation
nle04659  Th17 cell differentiation
nle04660  T cell receptor signaling pathway
nle04662  B cell receptor signaling pathway
nle04668  TNF signaling pathway
nle04920  Adipocytokine signaling pathway
nle05132  Salmonella infection
nle05135  Yersinia infection
nle05142  Chagas disease
nle05145  Toxoplasmosis
nle05160  Hepatitis C
nle05161  Hepatitis B
nle05162  Measles
nle05163  Human cytomegalovirus infection
nle05164  Influenza A
nle05165  Human papillomavirus infection
nle05166  Human T-cell leukemia virus 1 infection
nle05167  Kaposi sarcoma-associated herpesvirus infection
nle05168  Herpes simplex virus 1 infection
nle05169  Epstein-Barr virus infection
nle05170  Human immunodeficiency virus 1 infection
nle05200  Pathways in cancer
nle05203  Viral carcinogenesis
nle05212  Pancreatic cancer
nle05215  Prostate cancer
nle05220  Chronic myeloid leukemia
nle05221  Acute myeloid leukemia
nle05222  Small cell lung cancer
nle05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
nle05340  Primary immunodeficiency
nle05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:nle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100603768 (IKBKG)
   04014 Ras signaling pathway
    100603768 (IKBKG)
   04064 NF-kappa B signaling pathway
    100603768 (IKBKG)
   04668 TNF signaling pathway
    100603768 (IKBKG)
   04151 PI3K-Akt signaling pathway
    100603768 (IKBKG)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100603768 (IKBKG)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100603768 (IKBKG)
   04621 NOD-like receptor signaling pathway
    100603768 (IKBKG)
   04622 RIG-I-like receptor signaling pathway
    100603768 (IKBKG)
   04623 Cytosolic DNA-sensing pathway
    100603768 (IKBKG)
   04625 C-type lectin receptor signaling pathway
    100603768 (IKBKG)
   04660 T cell receptor signaling pathway
    100603768 (IKBKG)
   04658 Th1 and Th2 cell differentiation
    100603768 (IKBKG)
   04659 Th17 cell differentiation
    100603768 (IKBKG)
   04657 IL-17 signaling pathway
    100603768 (IKBKG)
   04662 B cell receptor signaling pathway
    100603768 (IKBKG)
   04062 Chemokine signaling pathway
    100603768 (IKBKG)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    100603768 (IKBKG)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100603768 (IKBKG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100603768 (IKBKG)
   05203 Viral carcinogenesis
    100603768 (IKBKG)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100603768 (IKBKG)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100603768 (IKBKG)
   05221 Acute myeloid leukemia
    100603768 (IKBKG)
   05220 Chronic myeloid leukemia
    100603768 (IKBKG)
   05215 Prostate cancer
    100603768 (IKBKG)
   05222 Small cell lung cancer
    100603768 (IKBKG)
  09163 Immune disease
   05340 Primary immunodeficiency
    100603768 (IKBKG)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100603768 (IKBKG)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100603768 (IKBKG)
   05135 Yersinia infection
    100603768 (IKBKG)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100603768 (IKBKG)
   05170 Human immunodeficiency virus 1 infection
    100603768 (IKBKG)
   05162 Measles
    100603768 (IKBKG)
   05164 Influenza A
    100603768 (IKBKG)
   05161 Hepatitis B
    100603768 (IKBKG)
   05160 Hepatitis C
    100603768 (IKBKG)
   05168 Herpes simplex virus 1 infection
    100603768 (IKBKG)
   05163 Human cytomegalovirus infection
    100603768 (IKBKG)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100603768 (IKBKG)
   05169 Epstein-Barr virus infection
    100603768 (IKBKG)
   05165 Human papillomavirus infection
    100603768 (IKBKG)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100603768 (IKBKG)
   05142 Chagas disease
    100603768 (IKBKG)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    100603768 (IKBKG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:nle01001]
    100603768 (IKBKG)
Protein kinases [BR:nle01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   100603768 (IKBKG)
SSDB
Motif
Pfam: CC2-LZ NEMO zf_C2H2_10 Bacillus_HBL LLC1
Other DBs
NCBI-GeneID: 100603768
NCBI-ProteinID: XP_030663509
Ensembl: ENSNLEG00000014311
LinkDB
Position
X
AA seq 419 aa
MSRHLWKSQLCEMVQPSGGPAADQDVLGEESPLGKPAMLHLPSEHGAPETLQRCLEENQE
LRDAIRQSNQMLRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQKEQ
ALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRARAASEQ
ARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQE
YDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPV
LKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKASCQESARIEDMRKRH
VEVSQAPLPPAPAYLSSPLALPSQRRSPPEEPPDFCCPKCQYQAPDMDTLQIHVMECIE
NT seq 1260 nt   +upstreamnt  +downstreamnt
atgagcaggcacctctggaagagccaactgtgtgagatggtgcagcccagtggtggcccg
gcagcagatcaggacgtgctgggcgaagagtctcctctggggaagccagccatgctgcac
ctgccttcagaacacggtgctcctgagaccctccagcgctgcctggaggagaatcaagag
ctccgagatgccatccggcagagcaaccagatgctgcgggagcgctgcgaggagcttctg
catttccaagccagccagagggaggagaaggagttcctcatgtgcaaattccaggaggcc
aggaaactggtggagagactcggcctggagaagctcgacctgaagaggcagaaggagcag
gctctgcgggaggtggagcacctgaagagatgccagcagcagatggctgaggacaaggcc
tctgtgaaagcccaggtgacgtccttgctcggggagctgcaggagagtcagagtcgcttg
gaggctgccactaaggaatgccaggctctggagggtcgggcccgggcggccagcgagcag
gcgcggcagctggagagtgagcgtgaggcgctgcagcagcagcacagcgtgcaggtggac
cagctgcgcatgcagggccagagcgtggaggccgcactccgcatggagcgccaggccgcc
tcggaggagaagaggaagctggcccagttgcaggtggcctatcaccagctcttccaagaa
tatgacaaccacatcaagagcagcgtggtgggcagcgagcggaagcgaggaatgcagctg
gaagatctcaaacagcagctccagcaggccgaggaggccctggtggccaaacaggaggtg
atcgataagctgaaggaggaggctgagcagcacaagattgtgatggagaccgttccggtg
ctgaaggcccaggcggatatctacaaggcggacttccaggctgagaggcaggcccgggag
aagctggccgagaagaaggagctcctgcaggagcagctggagcagctgcagagggagtac
agcaaactgaaggccagctgtcaggagtcagccaggatcgaggacatgaggaagcggcac
gtcgaggtctcccaggcccccttgccccccgcccccgcctacctctcctctcccctggcc
ctgcccagccagaggaggagcccccccgaggagccacctgacttctgctgtcccaagtgc
cagtatcaggcccctgatatggacaccctgcagatacatgtcatggagtgcattgagtag

DBGET integrated database retrieval system