KEGG   Numida meleagris (helmeted guineafowl): 110390809
Entry
110390809         CDS       T06015                                 

Gene name
CDKN1B
Definition
(RefSeq) cyclin-dependent kinase inhibitor 1B isoform X1
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
nmel  Numida meleagris (helmeted guineafowl)
Pathway
nmel04012  ErbB signaling pathway
nmel04068  FoxO signaling pathway
nmel04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:nmel00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    110390809 (CDKN1B)
   04068 FoxO signaling pathway
    110390809 (CDKN1B)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    110390809 (CDKN1B)
SSDB
Motif
Pfam: CDI XhlA
Other DBs
NCBI-GeneID: 110390809
NCBI-ProteinID: XP_021237993
LinkDB
Position
Unknown
AA seq 324 aa
MSNVRISNGSPTLERMEARQSEYPKPSACRNLFGPVNHEELNRDLKKHRKEMEEACQRKW
NFDFQNHKPLEGRYEWQAVEKGSSPDFYFRPPRLPKAVCKSAGRQSLDVNGNCQTAICAA
SQGISEDTHCVGRKTDVAGSQTDFAEQCAGQRKRPAADGNVPCGQRRAPGPAPASFRPNA
PGAARSSGSSAIPLLKIKEPTQRKRRFQKTPPVPIQWSKHPRNRARDDIKRKLPKAKDSR
FLAHRGAVKPGRYKVVVEMNTYRRSPWDGDSVQALKNNNSKTKKKADNNTKSLDTLKRPA
SKSIGCSIVQLGVSLFASLYYLCI
NT seq 975 nt   +upstreamnt  +downstreamnt
atgtcaaacgtccgcatttctaatggaagccctaccctggagcgcatggaggcgcggcag
tcggagtacccgaagccgtcggcctgcaggaacctcttcgggccggtaaaccacgaagag
ttaaacagggacttgaagaagcaccgcaaggaaatggaagaggcatgccagaggaagtgg
aatttcgatttccagaaccacaagccgctggaaggcaggtacgagtggcaagccgtggag
aaggggagctcgcccgacttctacttcagaccgccgaggctacccaaagccgtctgcaag
tccgccggccgtcagagcctggatgtaaacgggaattgccaaaccgcgatttgcgccgct
tctcagggaatctcagaggacactcactgtgtaggccgaaagactgatgttgctggcagt
cagacggactttgcagagcagtgcgccgggcagaggaaaagacccgccgccgacggtaac
gtaccctgcgggcagcgccgcgcgccgggcccggcccccgcctccttccgcccgaacgcc
cccggtgccgcccgcagctccgggagctccgcgattcctctcctcaaaataaaagagcca
acacaacggaagaggaggtttcagaagactcccccagtgccaattcagtggagcaaacac
ccaagaaatcgagcccgagacgacatcaaacgtaaactccctaaggcaaaggactcgcgt
ttccttgctcatcggggggcggtgaagccaggaagatataaagttgtagttgagatgaat
acatatcgtcggtctccgtgggatggggactctgtacaagcactgaaaaacaacaacagc
aaaacaaaaaaaaaagcagacaataacactaaaagtttagacactcttaaaagacctgcc
tctaaaagcatcggatgtagcattgtgcaattaggtgtttccttatttgcttcattgtac
tacctgtgtatatag

DBGET integrated database retrieval system