KEGG   Nipponia nippon (crested ibis): 104012648
Entry
104012648         CDS       T05756                                 

Gene name
CDKN1B
Definition
(RefSeq) cyclin-dependent kinase inhibitor 1B
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
nni  Nipponia nippon (crested ibis)
Pathway
nni04012  ErbB signaling pathway
nni04068  FoxO signaling pathway
nni04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:nni00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    104012648 (CDKN1B)
   04068 FoxO signaling pathway
    104012648 (CDKN1B)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    104012648 (CDKN1B)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 104012648
NCBI-ProteinID: XP_009463306
UniProt: A0A091V0V4
LinkDB
Position
Unknown
AA seq 198 aa
MSNVRISNGSPTLERMEARQSEYPKPSACRNLFGPVNHEELNRDLKKHRQEMEEACQRKW
NFDFQNHKPLEGRYEWQAVEKGSSPDFYFRPPRLLKAVCKSAGRQSLDVNGNCQTVVVVG
SQGISEDTHCVDQKTDVSENQTDFAEQCTGQRKRPAADDSSPQNKRANTTEEEVSEDSPS
ASSVEQTPKKSSPRRHQT
NT seq 597 nt   +upstreamnt  +downstreamnt
atgtcaaacgtccgtatttctaatgggagccctaccctggagcgcatggaagccaggcag
tcggagtacccgaagccgtcagcttgcaggaacctcttcgggccggtgaatcacgaagag
ttaaacagggacttgaagaagcaccgccaggagatggaggaggcatgccagaggaagtgg
aatttcgatttccagaatcacaagccgctggaaggcaggtacgagtggcaagccgtggag
aaggggagctcgcccgacttctacttcagaccccccaggctactgaaagctgtctgcaag
tccgccggccgccagagcttggatgtaaacgggaattgccaaaccgtggttgttgtcggt
tctcagggaatctcagaggacactcactgtgtagatcaaaagactgatgtttctgaaaac
cagacggactttgcagagcagtgcactgggcagaggaaaagacctgccgccgatgattcc
tctcctcaaaataaaagagccaacacaacagaagaagaggtttcagaagactcccccagt
gccagttcagtggagcaaacacccaagaaatcaagcccgagaagacatcaaacgtaa

DBGET integrated database retrieval system