KEGG   Nipponia nippon (crested ibis): 104021157
Entry
104021157         CDS       T05756                                 

Gene name
EGF
Definition
(RefSeq) pro-epidermal growth factor
  KO
K04357  epidermal growth factor
Organism
nni  Nipponia nippon (crested ibis)
Pathway
nni04010  MAPK signaling pathway
nni04012  ErbB signaling pathway
nni04020  Calcium signaling pathway
nni04068  FoxO signaling pathway
nni04510  Focal adhesion
nni04540  Gap junction
nni04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:nni00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104021157 (EGF)
   04012 ErbB signaling pathway
    104021157 (EGF)
   04068 FoxO signaling pathway
    104021157 (EGF)
   04020 Calcium signaling pathway
    104021157 (EGF)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104021157 (EGF)
   04540 Gap junction
    104021157 (EGF)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    104021157 (EGF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:nni04052]
    104021157 (EGF)
Cytokines and growth factors [BR:nni04052]
 Growth factors
  Growth factors (RTK binding)
   104021157 (EGF)
SSDB
Motif
Pfam: Ldl_recept_b cEGF FXa_inhibition EGF_CA EGF DUF5050 EGF_3 SGL hEGF
Other DBs
NCBI-GeneID: 104021157
NCBI-ProteinID: XP_009472927
UniProt: A0A091W1C3
LinkDB
Position
Unknown
AA seq 1254 aa
MFLFFVAFLPVVFKIGFVSLSALQHWNCPNGYRLKTENSACIDIDECLEGGLGTCGQTCI
NVPGSYICSCLPGYTLDIDKRSCYVNDPAPFLLFSHGNAIFRIDTEGTNHERLVADTGQS
TLLDFHYAEEKVYWVDSERRLLQRIHLNGTKRERLCYIEKGISGFAIDWINQDILWANRQ
KATIEATDMNGKKRRVLLRAAGRPTSITIDAEQRLLFWSSDGTVSSIHRVSLSGSDVRNV
LRTTEKIKAISLDLVDTRLYWIQHDHGKEISHIGSCNYDGRAVHLLKNSVRHQLLGMSLF
AEHLYYSELKSGMIWRANKYTGKVVVTISLKPSFFPPVEIKVVHPFRQPGARTDSQDFEK
GTCDFNKEKCRRRICRPDSRTHRCKCSSGFILSRNKQFCEDINECGFWNHGCTLGCVNVP
GSYYCTCPRGFGLLPDRKTCHELISCTSNDTECSHGCLQTSKGPVCFCPEGSVLKVDGKA
CTGCTSPDNGGCSQICSSLSPSSWECACFPGYKLQRDRKHCTAIGPKPFLLFANGQDIRQ
ISFDGTDYASLLDWQMGIVLALDFDPVENKIYFAHTALKWIERANLDGSNREKVIHEAID
TPEGLAVDWINRKLYWTDKGKACIERSNLNGMQRKMIIWEDISQPRGIAIHPFAKRLFWT
DMGANPRIDSSSLEGIDRQVIASTGLVWPSGIALDYLADKVYWCDAKQSVVESANLDGSG
RRILAQNDVGHPFDVAVFEDHLWFSDWARPSLMRVDKKTGQNRVRLRGSMLRPSSMVVVH
PLAKPGANPCLYENGGCDQICENNFGVAHCMCHPGFGKTQDGKACHALDASNTTAGSVSV
HKEVVPMPTPETLLQSTQSSGIFKDMDSGEKQKISILLMAEIMVSDQDDCTALECDVNAQ
CVLLEDGAMCQCLKGFTRKGKSCYDVDECAVNMDHCNRNVSGCINTEGGYVCKCLEGYTG
DGVHCYDIDECKMGSHTCGENVTCTNTEGNFTCSCADDASGTGTGCKATVAPTVVSNAYS
THPVQGDSIGCPPSYESYCLHGGVCNYVSDLQDYACNCVTGYVGERCQFSDLEWWEQQHA
ERVKMRNITIAVCVAVLVLLLLLGSLAAYCHRSQNLYKKNLYAEAIRDASSRADNENVTP
TSNKSQFVVVKECNSSLETKAVDLIECETTDPHPACPSEYVEEQPITYDKTAESLGEEEK
EGGCRQEAPAGEKSRQPMGAAKGPPQAPWSIHPKPLLEREPCQHAPASLLMQPD
NT seq 3765 nt   +upstreamnt  +downstreamnt
atgtttctcttctttgttgcttttttgccagtggtttttaaaattggttttgtcagcctc
tcagctctgcagcactggaactgtcctaatggatacagattaaagactgaaaactctgct
tgtatagatatcgacgaatgccttgaaggtggtttgggaacctgtggccaaacctgtatc
aatgttccagggtcctacatctgctcctgtttgcccggctacactttggatattgacaaa
cgatcttgctatgtgaatgaccctgcaccattcctactttttagccatggaaatgccatc
tttagaattgacactgaagggaccaatcacgaaagattggtagctgatactggtcagtca
acgcttctggattttcattatgcagaagaaaaagtgtattgggtagactctgaaaggcga
ctacttcaaagaattcacctgaatggcacaaaacgagagagactatgttacatagaaaaa
ggcatttcaggatttgctattgactggataaatcaagacattctctgggccaatagacag
aaagcaaccatagaagcaacagacatgaatgggaagaaacgccgagttcttttaagagct
gctggtcgtcccacaagcattaccattgatgctgagcaaaggctattattttggtcttca
gatggtacagtttccagcatacaccgggtgtccctcagtggaagtgatgtgagaaatgtt
ttaagaaccacagaaaaaataaaggccatctcactagatttggttgacacaaggctctac
tggatccagcatgaccacgggaaagagatttcacatattggatcatgcaactatgatggc
agagctgttcatttgctcaaaaattctgtccgacatcaattgcttggtatgtctctcttt
gctgagcacctgtactattcagagttgaaatctggtatgatatggagagccaacaagtat
actggaaaagttgtagtcacaattagcctgaagccatcattttttccaccggtggagata
aaagtggtgcatccctttagacagccaggtgcaagaacagattctcaggatttcgaaaaa
ggaacctgtgattttaacaaagaaaagtgcagaagaagaatctgcaggccagactcaagg
actcatcggtgtaaatgttctagtggctttattttaagtcgaaataaacagttttgtgaa
gatattaatgaatgtggcttctggaatcatggctgtactttgggctgtgtgaacgtccct
ggttcctattactgcacctgcccgagaggttttggtctgctgcctgataggaaaacatgt
catgagctaatttcctgtacgagtaatgacaccgaatgtagccatggttgccttcaaacg
tctaaagggcctgtttgcttttgtcctgaaggatctgtactcaaagtggatggcaaagca
tgcacgggttgtacatctccagataacggtggctgtagtcagatatgttcttctttaagc
ccatcctcctgggagtgtgcttgttttcctggatataagcttcagcgagacagaaagcac
tgcactgctataggtcctaagccatttttgttatttgcaaatggccaagacatccgccag
atcagttttgatggaacagattatgcaagtttacttgactggcagatgggaatagtctta
gcactggactttgacccagtggaaaataagatttactttgcccacaccgccttgaaatgg
atagaacgagctaatctggatggctcaaatcgtgaaaaagttattcatgaagctatagat
acacccgaaggccttgctgtggactggattaaccgaaaattgtactggacagacaaaggg
aaggcatgcattgaaaggagcaatctgaatggaatgcaaagaaaaatgatcatctgggag
gatatctcccagccccgagggattgccattcacccatttgctaagagattattctggact
gacatgggagccaatcctcggattgacagctcttcattagaaggcatcgatcgccaggtt
atagccagcactggtctggtgtggcccagtggaatagctctcgactacttagccgacaag
gtgtactggtgtgatgctaagcagtcggtggttgagagcgcaaacctggatggttctggt
cgtcgaattcttgcacagaatgatgtaggccacccttttgatgtagcagtgtttgaggat
cacctttggttttctgactgggctaggccatcgctaatgagggtggacaagaagaccggc
caaaacagggtacgtcttcgaggcagcatgctgagaccctcatcaatggttgtagttcat
cctttggcgaaaccaggggcaaacccttgcctttatgagaatggaggctgtgatcagatc
tgtgaaaacaattttggagttgcccattgcatgtgccatccaggatttgggaaaactcaa
gatggaaaagcctgtcatgctctggatgcttccaacacaacagcaggaagcgtctctgtg
cacaaggaggtagtgccgatgccaacaccagagaccttgctccagagcacacaaagcagt
gggatattcaaggatatggacagtggggaaaagcagaaaatcagcattttgttgatggct
gaaatcatggtatcagatcaagatgactgcactgcactagaatgtgatgtcaatgcacag
tgtgttttgctggaagatggtgctatgtgccagtgtttgaaaggatttaccaggaaggga
aaatcatgctatgatgttgatgagtgtgctgtaaatatggaccactgtaatcgaaatgtg
tcgggctgtatcaatacagaagggggctacgtctgtaaatgcctggagggctacactgga
gatggagtccattgctacgatattgatgagtgcaagatggggtcccacacctgtggagag
aacgtaacctgcacaaatacagaaggaaacttcacttgctcgtgtgctgatgatgcttct
ggaactggcaccggttgcaaagctactgtggcccccactgttgtcagcaatgcatactct
acacaccctgtccaaggtgattccataggatgccctccttcatacgagtcatactgcctc
catggtggagtgtgcaactatgtttctgatctacaagactatgcctgcaactgtgtgacg
ggctacgtcggggagcggtgccagttcagtgatctggagtggtgggagcagcagcacgcc
gagcgggtgaagatgcggaacatcaccattgcagtgtgtgtagcagtgctggtcctcctg
ctcctgctggggtccctggccgcctactgccacagaagtcaaaacttgtataagaagaat
ctctatgcagaagcgataagagatgccagcagccgtgctgacaatgagaacgtgacacct
actagcaacaagtctcagtttgtggttgttaaggagtgtaacagttctctggagactaaa
gcggttgatctaattgagtgtgagacaacagatcctcatcctgcctgtccttcagaatat
gtggaagaacagcctataacatatgacaaaacagcagagagtttgggagaagaggagaaa
gaaggcggctgtcgacaagaggctcctgctggtgagaaatcacgtcagcccatgggagcg
gcaaagggccctccccaggctccctggagcatccaccccaagcccctgctggaaagggag
ccctgccagcatgccccagccagcctgctgatgcagccggactag

DBGET integrated database retrieval system