KEGG   Nanorana parkeri: 108787307
Entry
108787307         CDS       T04897                                 

Gene name
KMT5A
Definition
(RefSeq) N-lysine methyltransferase KMT5A
  KO
K11428  [histone H4]-lysine20 N-methyltransferase SETD8 [EC:2.1.1.361]
Organism
npr  Nanorana parkeri
Pathway
npr00310  Lysine degradation
npr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:npr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    108787307 (KMT5A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:npr03036]
    108787307 (KMT5A)
Enzymes [BR:npr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.361  [histone H4]-lysine20 N-methyltransferase
     108787307 (KMT5A)
Chromosome and associated proteins [BR:npr03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     108787307 (KMT5A)
SSDB
Motif
Pfam: SET ERp29 Ndc1_Nup
Other DBs
NCBI-GeneID: 108787307
NCBI-ProteinID: XP_018412327
LinkDB
Position
Unknown
AA seq 327 aa
MGKGKKMSKTGDGRSGEAPETCRSNENKPKMNGDLGHGGQSKIDSYMTPAKTPSARPPLQ
EENSTPFHEGKDMRKASSGTRKKAEVPESERPSTATDDKDRESSVSDSAQGQKQTLTAEP
QKKLPPADRKPEPHRMVKAKSNRRKVHVTKSPNRKVTDYFQVRRSFRKNKTELESEEKKR
IDDLITSGKEEGMKIDIITGKGRGVIATRDFCRGEFVVEYYGDLIEITDAKKREAAYARD
DSTGCYMYYFQFQNKTYCVDATKETNRLGRLINHSKSGNCHTKLHNIKNLPHLILVASRD
ISAGEELLYDYGDRSKSSIEAHPWLKN
NT seq 984 nt   +upstreamnt  +downstreamnt
atgggcaaaggaaagaaaatgtctaaaaccggcgacggaagaagcggggaggcaccggaa
acctgtcgatccaatgagaacaagccgaaaatgaacggggatctgggacatggaggtcaa
tcaaaaatcgactcttatatgacccctgctaaaacgcctagcgcgcgtccgcctcttcag
gaagaaaactccactccgttccatgagggtaaagatatgaggaaagcctcttcaggcact
cgcaaaaaagcagaagttcctgaatcagaacggccaagcacagccacagatgacaaggac
cgtgaaagtagtgtgtcagatagtgcccagggccagaaacaaactttgactgctgagcca
caaaagaagttaccccctgctgacaggaagccggagccacataggatggtcaaagcaaaa
tctaacagacggaaagtacatgtaaccaagtctccaaacagaaaagttacagactatttt
caagttagaagaagctttaggaaaaacaaaacagaactagagtccgaggaaaagaaaaga
atagatgacctaattacaagtggcaaagaggaggggatgaagatcgacataattactggt
aaaggccgaggtgtgattgcaactcgggatttttgtcgtggagaatttgttgtcgaatac
tacggggatcttatagagattacagatgcaaagaaacgagaagcagcatatgcccgggac
gactccactggctgctacatgtactacttccagtttcaaaataaaacctactgtgttgat
gcaacaaaagaaacgaaccgtttaggaaggcttataaatcacagtaagagcggaaattgc
cacaccaaactacacaatatcaagaacttgcctcacctcatattggttgcatcaagggac
ataagcgcaggggaagaacttttgtatgactatggagatcggagcaagtcctccattgaa
gcacatccttggcttaagaattga

DBGET integrated database retrieval system