KEGG   Nanorana parkeri: 108800629
Entry
108800629         CDS       T04897                                 

Gene name
WHSC1L1
Definition
(RefSeq) histone-lysine N-methyltransferase NSD3
  KO
K11425  [histone H3]-lysine4 N-dimethyltransferase / [histone H3]-lysine27 N-dimethyltransferase [EC:2.1.1.370 2.1.1.371]
Organism
npr  Nanorana parkeri
Pathway
npr00310  Lysine degradation
npr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:npr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    108800629 (WHSC1L1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:npr03036]
    108800629 (WHSC1L1)
Enzymes [BR:npr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.370  [histone H3]-lysine4 N-dimethyltransferase
     108800629 (WHSC1L1)
    2.1.1.371  [histone H3]-lysine27 N-dimethyltransferase
     108800629 (WHSC1L1)
Chromosome and associated proteins [BR:npr03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     108800629 (WHSC1L1)
SSDB
Motif
Pfam: PWWP C5HCH SET AWS PHD zf-HC5HC2H_2 zf-HC5HC2H
Other DBs
NCBI-GeneID: 108800629
NCBI-ProteinID: XP_018428119
LinkDB
Position
Unknown
AA seq 1447 aa
MDFSFSFMQGIMGNTIQQPPQLIDSANNRQDDANSSDQADEGGHTPYDSGLQPDFQYHTP
TTEDLPTLTNGYQSSLGYDSQIKYQAYSQFPNGSANGYGNRNFSTLEYYHHLETAAMRPQ
EGALKSSPPQPTSPPMSLQPPPSSTTFTPKKTGSPEIKLRITKTIQNGREMFESSLCGDL
RHEFQAGEFNRKKHERRRERKEKRKKSSRHHHHHHHHHHREEVTVEEPQPDTIQKLDPPE
EEIIEQNPISPLSPEVRTGVWFHVGDLVWSKVGTYPWWPCMVSCDPQLHVHSKINSRDKS
AREYHVQFFSNEPERAWIHEKRMREYRGRKQYELLAAEDAAKVVNQSERLKMRKPRPQKE
RIQWEIGIAHAEKALRMTREERIEQYTFIYVDPESSPEPKKPAPSKKLRRSTSSSEAESA
RSLDITKSPSAPQSISSSRDSRDSVPETRRQSQRKQAPPPPEEEVPPPPQPPPPPPPPKI
PWKTAAARKSLPASVLLHKGTIDLQKCNMSPVVKIENVLALKNASSEGIDQFIFTTKGDG
NKPEITIKLTEKTPAPSPNLKVEKTSAQHTPAPETSSGATGSSEKKHQRRSNRTRSESEK
SLDSLPKKKVKKEQAEDIPLTAVQIGLQKGASEISDACKPLKKRSRASTDVELANSSYRD
ASDSDSRGLNDAQISFDKQPDSPSANADADASDVQSVDSSVSRWSSKRDTVCQICESYGE
SLVSCDGDCSRLFHMECLGMDALPDGKFICMECKTGLHTCFSCKIPSTSVRRCSVPSCGK
FYHEACARQYSGTVFDSKGFRCPHHCCSSCSADKDMYRACKGRMLRCVRCPVAYHSGDNC
VAAGSLILTGSLIICSNHSKRSGHSSSAVNVSFCFVCARGLIVQDYTLVSSMSFKSHFLL
NDSKRAELMKIPMIPSSSPAFLKKSEKGGGKLLCCDSCPAAFHPSCLNIEMPQGSWSCND
CRTGKKLHYKQIVWVKLGNYRWWPAEICNPRSVPLNIQGLKHDIGDFPVFFFGSHDYYWV
HQGRVFPYVEGDKTFAEGQTSINKTFKKALEEAAKRFQELKAQRESKEALEVERNSRKPP
PYKHIRSNKAVGKVQIQVADVSEIPRCNCRPADESPCGLDSQCLNRMLLYECHPQACPAG
ERCQNQSFTKRLYPETEIFRTERRGWGLLCKRDIRKGEFVNEYVGELIDEEECRSRLKRS
HENGVTNFYLLTVTKDRIIDAGPKGNYSRFMNHSCNPNCDTQKWTVNGDVRVGLFALCDI
PQGTELTFNYNLDCLGNGRTECHCGADNCSGFLGVRPKTACATATEEKAKNARLKAKKRK
IKTEQKQMHEDYCFRCGDGGELVMCDKRDCPKAYHLLCLNLTQPPYGKWDCPWHQCDKCG
SPSSSFCEFCPSSFCKEHEKGELTISSLEGRLCCSEHDPRRPLACGEKKFKFKIECEDSS
LQSFVPL
NT seq 4344 nt   +upstreamnt  +downstreamnt
atggatttctccttctctttcatgcaagggatcatgggaaacacaatccagcaaccccct
caactcatcgactcagccaacaaccggcaggatgatgccaacagcagcgatcaggctgac
gagggcggtcacacgccctatgattctggtctgcagccggacttccagtaccacacgcct
accaccgaggacttgccaaccctcaccaacggctaccagtcctcgctgggctatgactct
cagatcaaataccaagcgtattcccagttccccaacggctcggccaatgggtacggcaac
agaaacttcagtaccctggagtattaccaccatctggagactgccgccatgcggcctcag
gagggggcgctgaaatcgtctccccctcagcccacctcccctccgatgagtctccaacct
cctccttcctcgaccacttttacccccaaaaagaccggctccccggagatcaaactaaga
atcacaaagacaattcagaacgggcgggagatgttcgagtcctcgctctgcggggatctc
cgccacgagttccaggccggcgaattcaaccggaaaaagcacgagcgacgtcgggaaagg
aaggagaagaggaagaagagcagcaggcatcatcatcaccaccatcaccatcaccaccgc
gaggaggtgacggtagaggaaccccaacccgacacgattcaaaaactggaccctccggag
gaggagataattgaacagaacccgatttctccattatctcctgaggtcaggactggcgtc
tggtttcatgtaggagacttggtttggtctaaggtgggaacgtacccttggtggccctgt
atggtgtcctgtgacccccagctccatgtgcacagcaagatcaattccagagataagagt
gctcgtgaataccatgtgcagtttttcagcaacgagccggaaagagcctggatacacgag
aagcgcatgcgggaataccgagggcggaaacagtatgagctactggcggctgaagatgct
gctaaagtagttaaccagtcagaaaggctcaagatgaggaagccccggccgcagaaggaa
cgcattcagtgggagatcggcatcgcccatgctgagaaagcgctacggatgacacgggag
gagagaatagagcagtacaccttcatctacgtagatccagaaagctctcctgaacccaaa
aagccagcaccaagtaaaaagcttcggagatccacatcaagtagtgaggcagaatctgcc
cgttcattggacattaccaaatccccctcggcacctcagtctatttcttcgtcgagagac
tctagagactctgtacctgaaacccgtaggcagagccagagaaaacaggcaccgcctcct
ccagaggaagaggtaccgccacctcctcagcctccgcctcctcctcctcctcccaaaatc
ccctggaagacggcagctgcccgcaaatcccttcctgcttcagttcttctgcacaagggc
accattgaccttcagaagtgcaatatgtcacctgtggtgaaaatagagaatgttttagcc
ctcaaaaatgcctcttctgaaggtatcgaccaattcatattcacaaccaagggagatgga
aacaagccggaaatcacaattaaattgacggaaaagacgcccgcaccctcccccaacttg
aaggttgagaaaacgtcagcacaacacacgcctgctcctgaaacatcatcgggggccaca
gggagctcagagaagaaacaccagagaaggtctaaccggactcgatcggaatctgagaag
tccctggactctttgccaaagaagaaggtgaagaaagagcaggcggaagacatcccttta
accgcggtacagattgggttgcagaaaggggccagcgagatctctgacgcatgcaagcct
ctgaagaagagaagccgcgcctccaccgacgtggagcttgcaaattcctcctaccgcgat
gcttcagactctgactcccgcggcctgaacgacgcgcagatcagctttgataagcagccg
gacagcccatcggccaatgcagacgcagatgcctctgatgtgcagtcggtagattccagc
gtatctcggtggtcaagcaagagagacacggtgtgccagatctgtgaaagttatggggag
tcgctggtgtcttgcgatggggactgctctcgtctcttccacatggagtgtctgggcatg
gatgcattgccagatgggaagttcatctgcatggagtgcaagaccggtctccacacttgt
ttctcctgcaagatccccagtaccagtgtcaggcgctgctccgtaccttcgtgtgggaaa
ttttaccacgaagcctgcgcccgccagtattcaggaacggtcttcgactcgaagggcttc
cggtgcccgcaccactgctgtagctcttgcagcgctgacaaggacatgtacagagcctgt
aaagggcgcatgttacgctgtgtgcggtgcccagtggcgtatcacagtggagacaactgc
gtggctgcgggcagcctcatcctcactggtagcctcatcatttgcagcaaccattccaag
cgcagtgggcactcttcctctgccgtcaacgtgagcttctgcttcgtttgtgctcgaggg
ctgatagttcaggattataccctggtcagttctatgtcctttaagtcccactttctactg
aatgactcaaagcgtgcagagttgatgaaaatacctatgattccttcttcctcgccagct
ttcctaaagaaatctgagaaaggaggcggcaaactcctatgctgcgattcgtgcccagcc
gccttccacccttcctgtctcaacatagagatgccgcaaggatcctggagctgcaatgac
tgcaggacgggcaagaagctgcactacaagcagattgtctgggtcaagcttggaaattac
agatggtggccagctgagatctgcaatccgaggtccgttccactcaatatccagggcctg
aaacatgacataggagacttcccagttttcttctttggctcgcatgattattactgggta
caccagggtcgtgtgtttccctatgtagaaggggataaaacctttgcagagggccagacc
agtattaacaaaactttcaagaaagctctggaagaggctgctaagaggttccaggaactg
aaggctcagcgggagagtaaagaagcactagaagtggagagaaactccagaaaaccaccc
ccatacaagcacatcaggagcaacaaagcggtgggaaaagttcagatccaggtggcggat
gtctcggaaatacctcgttgtaactgtcgtcccgccgacgaatctccgtgtggcctggac
tcgcagtgcctgaaccgcatgttgctttatgagtgccacccgcaggcgtgccctgctggg
gagcgatgccaaaaccagagcttcaccaagcggctctacccagagaccgagatcttccgc
actgagaggagaggctggggccttctgtgcaagagagatattcgaaagggtgagtttgtg
aacgaatatgtcggggagctgatcgacgaggaggagtgcagatctcgcttgaaacgatcc
catgaaaatggagtcaccaacttctacttgctcactgtcaccaaggatcgtattatagac
gctggccccaaggggaattactcccggttcatgaatcacagctgtaaccccaactgcgat
acccagaagtggacggtgaacggtgatgtgagagtcggactgtttgctctttgtgacata
cctcaaggcactgagctaacatttaactataatcttgactgtctgggaaacggccggacg
gagtgtcattgtggtgcagataactgcagtggcttcttgggggtacgaccaaaaacagct
tgcgctacagcaacggaagaaaaggccaaaaacgctcgcttaaaagcaaagaaacgcaaa
attaaaacagaacagaaacagatgcatgaagattactgtttccgctgtggtgatggaggg
gagctggtgatgtgtgataaaagagactgtcctaaagcttatcacctcctctgccttaac
ctgacacagccgccgtatgggaaatgggactgcccgtggcatcagtgtgacaaatgcgga
tccccgtcttcatcgttctgtgaattctgcccttcgtctttctgcaaagagcacgagaaa
ggagagttgacaatctcatctctggaagggagactgtgctgctccgagcatgacccccgg
cgcccattggcatgcggagagaagaaatttaaatttaaaatagagtgcgaggattcctca
ttgcaatcctttgttcccctgtga

DBGET integrated database retrieval system