KEGG   Nicrophorus vespilloides: 108561583Help
Entry
108561583         CDS       T04922                                 

Definition
(RefSeq) angiotensin-converting enzyme
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
nvl  Nicrophorus vespilloides
Brite
KEGG Orthology (KO) [BR:nvl00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:nvl01002]
    108561583
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:nvl04147]
    108561583
   04090 CD Molecules [BR:nvl04090]
    108561583
Enzymes [BR:nvl01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     108561583
Peptidases [BR:nvl01002]
 Metallo Peptidases
  Family M2
   108561583
Exosome [BR:nvl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   108561583
CD molecules [BR:nvl04090]
 Proteins
  108561583
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M2
Motif
Other DBs
NCBI-GeneID: 108561583
NCBI-ProteinID: XP_017775072
LinkDB All DBs
Position
Unknown
AA seq 656 aa AA seqDB search
MCDFPKKTLIVVAFFAGGMSVPQLDLPQYDQQQQQQQQQPQNPSVDYTNYNYDRNPNYDR
DTYDRNPIYDRNLNYNSNPNIPQQNNNNNDNNNENRRNNEDGYSYNGDIRQLLQALDLQA
SQQCTSNVAAQWNFETNVNQVTQLEALNAQQLYSDFQHGIWELFSKVRNSNIPDIMTYRQ
IRFMSVVGPAALAPDQLDRYNRLINDMLSIYNQASICAQNEPFRCGLRLQPDLTHTMATS
RNWDELQYVWTEWRRNTGQHIKDSFEQLVTLSNEASRLNNFTDTAEYWNFPFESSSLNLE
LEDVWEEVKPLYELLHAYVRRRLRDFYGPDKINRQAPLPAHILGNMWAQSWTNIFEITQP
YPGREYLDVTPEMEKQGYAPIDIFRLAEDFFVSMNMTALPIDFWASSILEEPTDRVVICQ
PSAWDFCNSRDFRIKMCTKITMKDLVTAHHEMAHIHYFINYRNQPKVFRDGANPGFHEAI
GEAIGLSVSTPKHLQTLGLLQSSIDDSALDINFLYQMALDKVAFLPFAFLMDKWRYQIFK
GEITKEQYNCQFWRLSXXXXXXXXXXXXXXXXXXXXLRYFVSTILQFQIYRSMCQAAGQF
NPNDPSKPLHKCDVYRSREAGQILSNLMEKGSSLPWSDVLFQATGESRLSGSALRX
NT seq 1971 nt NT seq  +upstreamnt  +downstreamnt
atgtgcgatttcccgaagaagaccctcatcgtggtagcgttcttcgctggaggaatgtcc
gtaccgcagctagatttaccccagtacgatcagcagcaacagcaacagcagcagcaaccc
cagaatccgagcgtagattacacgaattacaattacgacaggaatcccaattacgatcgg
gacacctacgatcgaaatcccatctacgatcgcaacctaaattacaactccaatcccaac
atcccccagcaaaacaacaacaacaatgataacaacaatgaaaacagaaggaacaacgag
gatgggtacagctacaacggtgacatccgtcagttgcttcaggctttggatcttcaggcc
tctcagcaatgcaccagcaacgttgcggcccaatggaatttcgagacgaacgtcaatcaa
gttacccaactcgaagcgctgaatgcgcaacagctgtattccgatttccagcacgggatt
tgggagctcttctccaaagtgaggaacagcaacatcccggatataatgacctacaggcag
atccggttcatgtccgttgtgggacccgcggctttagccccggatcaattggatagatat
aatcgattgatcaacgacatgttgtcaatatacaatcaggcttcgatctgcgcccaaaac
gagcctttccgatgcggcttaaggctgcaaccggacttgacccacaccatggctacaagc
agaaattgggatgaactccaatacgtgtggacggagtggaggaggaacaccgggcaacac
atcaaagactccttcgagcagctggtcaccctctccaacgaagcatcacgtctcaacaat
tttactgatacggcggagtactggaacttcccgttcgaatcgtcttcgctcaacttggaa
ttggaggatgtctgggaggaggtcaagcctttgtatgaacttcttcacgcgtacgtgaga
cgtcgtctgagggatttttacgggccggataagatcaacaggcaggcgcctcttcccgct
cacattttgggaaatatgtgggcgcaatcgtggacgaacatcttcgaaattacgcaaccg
tatccgggtcgtgagtatctggatgtgacaccggaaatggagaaacagggttacgctcct
atcgatatctttagattagccgaagacttcttcgtgtccatgaacatgaccgcactgccg
attgatttctgggccagctcaatcctagaagagcccacagatcgtgtcgttatttgccaa
ccttccgcttgggatttctgcaatagcagagattttagaataaagatgtgcacgaaaata
acgatgaaagatttggtcactgcccaccacgagatggcccacatccattacttcataaac
tacaggaatcagccgaaagtgttcagagacggggcgaatccaggttttcacgaagcgata
ggcgaagcgatcggtctttcagtgagcactccgaagcatctgcagactttaggacttctg
caatcttccatagacgattccgctttggatataaacttcttgtatcagatggctttagac
aaagtggcttttctaccgttcgctttcttgatggacaagtggagataccagatcttcaaa
ggggaaatcaccaaggaacagtacaactgccaattctggaggctcagtgnnnnnnnnnnn
nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnttgagatacttt
gtgagcacaattctccaattccaaatctacagatcgatgtgtcaagccgcaggtcaattc
aacccgaacgatccatcgaaacctctgcacaagtgcgacgtatacaggagtcgcgaggcc
ggtcaaatactgagtaatttgatggagaaaggttcgtctttgccgtggagcgacgtcctg
ttccaagcgacgggagagtcgcggctgagcggatcagcgctgagggantga

DBGET integrated database retrieval system