KEGG   Ovis aries (sheep): 100127219
Entry
100127219         CDS       T03117                                 

Gene name
CDKN1B
Definition
(RefSeq) cyclin-dependent kinase inhibitor 1B
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
oas  Ovis aries (sheep)
Pathway
oas01522  Endocrine resistance
oas04012  ErbB signaling pathway
oas04066  HIF-1 signaling pathway
oas04068  FoxO signaling pathway
oas04110  Cell cycle
oas04151  PI3K-Akt signaling pathway
oas04933  AGE-RAGE signaling pathway in diabetic complications
oas04934  Cushing syndrome
oas05162  Measles
oas05165  Human papillomavirus infection
oas05169  Epstein-Barr virus infection
oas05200  Pathways in cancer
oas05202  Transcriptional misregulation in cancer
oas05203  Viral carcinogenesis
oas05206  MicroRNAs in cancer
oas05215  Prostate cancer
oas05220  Chronic myeloid leukemia
oas05222  Small cell lung cancer
oas05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:oas00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100127219 (CDKN1B)
   04066 HIF-1 signaling pathway
    100127219 (CDKN1B)
   04068 FoxO signaling pathway
    100127219 (CDKN1B)
   04151 PI3K-Akt signaling pathway
    100127219 (CDKN1B)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100127219 (CDKN1B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100127219 (CDKN1B)
   05202 Transcriptional misregulation in cancer
    100127219 (CDKN1B)
   05206 MicroRNAs in cancer
    100127219 (CDKN1B)
   05203 Viral carcinogenesis
    100127219 (CDKN1B)
  09162 Cancer: specific types
   05226 Gastric cancer
    100127219 (CDKN1B)
   05220 Chronic myeloid leukemia
    100127219 (CDKN1B)
   05215 Prostate cancer
    100127219 (CDKN1B)
   05222 Small cell lung cancer
    100127219 (CDKN1B)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100127219 (CDKN1B)
   04934 Cushing syndrome
    100127219 (CDKN1B)
  09172 Infectious disease: viral
   05162 Measles
    100127219 (CDKN1B)
   05169 Epstein-Barr virus infection
    100127219 (CDKN1B)
   05165 Human papillomavirus infection
    100127219 (CDKN1B)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100127219 (CDKN1B)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 100127219
NCBI-ProteinID: XP_004006899
Ensembl: ENSOARG00000020853
UniProt: W5QI61
LinkDB
Position
3
AA seq 198 aa
MSNVRVSNGSPSLERMDARQAEYPKPSACRNLFGPVNHEELTRDLEKHCRDMEEASQRKW
NFDFQNHKPLEGKYEWQEVEKGNLPEFYYRPPRPPKGACKVPAQEGQDASGARPAVPLLG
SQANPEDTHLVDQKTDAPDSQTGLAEQCPGIRKRPAADDSSPQNKRANRTEENVSDGSPN
AGSVEQTPKKPGLRRRQT
NT seq 597 nt   +upstreamnt  +downstreamnt
atgtcaaacgtgcgagtgtctaacgggagcccgagcctggagcggatggacgccagacag
gcggagtaccccaagccctcggcttgcagaaacctctttggcccggtcaatcacgaagag
ttaacccgggacttggagaagcattgcagagacatggaagaggccagccagcgcaagtgg
aattttgattttcagaatcacaagcccctggagggcaagtacgagtggcaggaggtagaa
aagggcaacctgcccgagttctactacagacccccgcggccacccaaaggcgcctgcaag
gtgccggcgcaggaaggccaggatgccagcggggcccgcccggcggtgcctttacttggg
tctcaggcaaacccagaggacacgcatttggtcgatcagaagactgatgccccggacagc
cagaccgggttagcggagcagtgccccgggataaggaagcgacctgccgcagatgattcc
tctcctcaaaacaaaagagccaacagaacagaagaaaatgtttcagacggttcccccaac
gccggttcagtggagcagacgcccaagaagcctggcctcagaaggcgtcagacgtaa

DBGET integrated database retrieval system