KEGG   Oryctolagus cuniculus (rabbit): 100328929
Entry
100328929         CDS       T03373                                 

Gene name
RLA-DR-ALPHA
Definition
(RefSeq) major histocompatibility complex, class II, DR alpha
  KO
K06752  MHC class II antigen
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04145  Phagosome
ocu04514  Cell adhesion molecules
ocu04612  Antigen processing and presentation
ocu04640  Hematopoietic cell lineage
ocu04658  Th1 and Th2 cell differentiation
ocu04659  Th17 cell differentiation
ocu04672  Intestinal immune network for IgA production
ocu04940  Type I diabetes mellitus
ocu05140  Leishmaniasis
ocu05145  Toxoplasmosis
ocu05150  Staphylococcus aureus infection
ocu05152  Tuberculosis
ocu05164  Influenza A
ocu05166  Human T-cell leukemia virus 1 infection
ocu05168  Herpes simplex virus 1 infection
ocu05169  Epstein-Barr virus infection
ocu05310  Asthma
ocu05320  Autoimmune thyroid disease
ocu05321  Inflammatory bowel disease
ocu05322  Systemic lupus erythematosus
ocu05323  Rheumatoid arthritis
ocu05330  Allograft rejection
ocu05332  Graft-versus-host disease
ocu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100328929 (RLA-DR-ALPHA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100328929 (RLA-DR-ALPHA)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100328929 (RLA-DR-ALPHA)
   04612 Antigen processing and presentation
    100328929 (RLA-DR-ALPHA)
   04658 Th1 and Th2 cell differentiation
    100328929 (RLA-DR-ALPHA)
   04659 Th17 cell differentiation
    100328929 (RLA-DR-ALPHA)
   04672 Intestinal immune network for IgA production
    100328929 (RLA-DR-ALPHA)
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    100328929 (RLA-DR-ALPHA)
   05322 Systemic lupus erythematosus
    100328929 (RLA-DR-ALPHA)
   05323 Rheumatoid arthritis
    100328929 (RLA-DR-ALPHA)
   05320 Autoimmune thyroid disease
    100328929 (RLA-DR-ALPHA)
   05321 Inflammatory bowel disease
    100328929 (RLA-DR-ALPHA)
   05330 Allograft rejection
    100328929 (RLA-DR-ALPHA)
   05332 Graft-versus-host disease
    100328929 (RLA-DR-ALPHA)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100328929 (RLA-DR-ALPHA)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100328929 (RLA-DR-ALPHA)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    100328929 (RLA-DR-ALPHA)
   05152 Tuberculosis
    100328929 (RLA-DR-ALPHA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100328929 (RLA-DR-ALPHA)
   05164 Influenza A
    100328929 (RLA-DR-ALPHA)
   05168 Herpes simplex virus 1 infection
    100328929 (RLA-DR-ALPHA)
   05169 Epstein-Barr virus infection
    100328929 (RLA-DR-ALPHA)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100328929 (RLA-DR-ALPHA)
   05140 Leishmaniasis
    100328929 (RLA-DR-ALPHA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ocu04147]
    100328929 (RLA-DR-ALPHA)
Exosome [BR:ocu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100328929 (RLA-DR-ALPHA)
  Exosomal proteins of epithelial cells
   100328929 (RLA-DR-ALPHA)
  Exosomal proteins of breast milk
   100328929 (RLA-DR-ALPHA)
SSDB
Motif
Pfam: MHC_II_alpha C1-set Ig_3 Marek_A
Other DBs
NCBI-GeneID: 100328929
NCBI-ProteinID: NP_001164589
Ensembl: ENSOCUG00000009103
UniProt: Q30847
LinkDB
Position
12
AA seq 255 aa
MAISGGVPVLGFFIIAILMSPQKSWAIKEEHVIIQAEYFLSPDDLGEFMFDFDGDEIFHV
DMDKKETVWRLKEFGQFASFEAQGALANIAVDRANLDIMIKRSNHTPDTNVPPEVTLLPS
SPVELGEPNVLICFIDKFSPPVINVTWLRNGNPVTMGVSETVFLPRDDHLFRKFHYLPFL
PSTEDVYDCKVEHWGLEEPTLKHWEFEARTPLPETTENVVCALGLVVGLVGIIVGTIFII
KGVHKGNATERRGTL
NT seq 768 nt   +upstreamnt  +downstreamnt
atggccataagcggtggagtaccagtcctgggctttttcatcattgctattctgatgagc
cctcagaagtcttgggctatcaaagaggaacacgtgatcatccaggccgagtactttctg
tcccctgacgatttaggagagttcatgtttgactttgatggtgatgagattttccatgtg
gatatggacaaaaaagagacagtctggcggcttaaagaattcggacaatttgccagcttt
gaggcccagggtgcactggcaaatatagcagtggacagagccaacctggacatcatgata
aagcgctccaatcacaccccagacaccaatgtgcctccagaggtgactctgctcccaagc
agccctgtggaactgggagagcccaacgtcctcatctgtttcatcgacaagttctcccca
cctgtgatcaatgtcacatggctccgaaatggaaaccctgtcaccatgggagtatcagaa
acagtcttcctgcccagggatgaccaccttttccgcaaattccactatctccccttcctg
ccctcgaccgaggacgtctatgactgcaaagtggagcactggggtttggaggagcctact
ctcaagcactgggagtttgaagcacgaacccctctcccagagactacagaaaatgtggtg
tgtgccctagggctggttgtgggtctggtgggcatcattgttggcaccatcttcatcatc
aagggcgtgcacaagggcaatgctacagaacgccgggggaccctgtga

KEGG   Oryctolagus cuniculus (rabbit): 100341358
Entry
100341358         CDS       T03373                                 

Definition
(RefSeq) RLA class II histocompatibility antigen, DP beta chain
  KO
K06752  MHC class II antigen
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04145  Phagosome
ocu04514  Cell adhesion molecules
ocu04612  Antigen processing and presentation
ocu04640  Hematopoietic cell lineage
ocu04658  Th1 and Th2 cell differentiation
ocu04659  Th17 cell differentiation
ocu04672  Intestinal immune network for IgA production
ocu04940  Type I diabetes mellitus
ocu05140  Leishmaniasis
ocu05145  Toxoplasmosis
ocu05150  Staphylococcus aureus infection
ocu05152  Tuberculosis
ocu05164  Influenza A
ocu05166  Human T-cell leukemia virus 1 infection
ocu05168  Herpes simplex virus 1 infection
ocu05169  Epstein-Barr virus infection
ocu05310  Asthma
ocu05320  Autoimmune thyroid disease
ocu05321  Inflammatory bowel disease
ocu05322  Systemic lupus erythematosus
ocu05323  Rheumatoid arthritis
ocu05330  Allograft rejection
ocu05332  Graft-versus-host disease
ocu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100341358
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100341358
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100341358
   04612 Antigen processing and presentation
    100341358
   04658 Th1 and Th2 cell differentiation
    100341358
   04659 Th17 cell differentiation
    100341358
   04672 Intestinal immune network for IgA production
    100341358
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    100341358
   05322 Systemic lupus erythematosus
    100341358
   05323 Rheumatoid arthritis
    100341358
   05320 Autoimmune thyroid disease
    100341358
   05321 Inflammatory bowel disease
    100341358
   05330 Allograft rejection
    100341358
   05332 Graft-versus-host disease
    100341358
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100341358
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100341358
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    100341358
   05152 Tuberculosis
    100341358
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100341358
   05164 Influenza A
    100341358
   05168 Herpes simplex virus 1 infection
    100341358
   05169 Epstein-Barr virus infection
    100341358
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100341358
   05140 Leishmaniasis
    100341358
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ocu04147]
    100341358
Exosome [BR:ocu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100341358
  Exosomal proteins of epithelial cells
   100341358
  Exosomal proteins of breast milk
   100341358
SSDB
Motif
Pfam: MHC_II_beta C1-set Ig_3 Marek_A Ig_2 ig C2-set_2
Other DBs
NCBI-GeneID: 100341358
NCBI-ProteinID: XP_008260991
Ensembl: ENSOCUG00000008721
UniProt: G1SVQ7
LinkDB
Position
12
AA seq 253 aa
MRPCRSLRTAALAVVLTVLLHPVALGRATPENYLWQRRYECYASNGTQRLLDRCAYNREE
FVRFDSDIGEFRAVSELGRQVAESWNLEYLQQARAEVDRVCRHNYELFQGLPVLLQAQPR
VSVSPSKKGPLQHHSLLVCHVTDFYPGHVQVRWFLNGREETAGVVSTHPIHNGDWTFQIL
VMLEMTPHQGDVYTCHVEHPSLDSPITVEWKAQSDSARSKMLAGVGGLVLGLVSLAVGVF
MHRRSKKAQQGCR
NT seq 762 nt   +upstreamnt  +downstreamnt
atgaggccctgcaggtccctgaggacagcggcgctggcggtggtactgacggtgctgctc
caccctgtggccctgggcagggccactccagagaactacctgtggcagagacgatatgaa
tgctacgcctccaacgggacgcagcgcttgctggacagatgcgcctacaacagggaggag
ttcgtgcgcttcgacagcgacatcggggagttccgcgccgtcagcgagctcggccggcag
gtcgccgagtcctggaacctggaatacctgcagcaggcgcgggccgaggtggacagggtg
tgcagacacaactacgagttgttccagggtctccccgtgctgctccaagcccagccccga
gtgagcgtctccccctccaagaaggggcccctgcagcaccacagcttgctcgtctgccac
gtgacagatttctatccaggccacgttcaagtccgttggttcctgaatggacgggaggaa
acagccggggtcgtgtccacccacccgatccataatggagactggaccttccagatcctg
gtgatgctggaaatgaccccccaccagggagacgtctacacctgccacgtggagcacccc
agcctggacagtcccatcactgtggagtggaaggcacagtctgattccgcccggagcaag
atgctcgctggcgtcggggggttagtgctggggctcgtctcgctggcagtgggcgtcttc
atgcacaggaggagcaagaaagctcagcaaggatgtcggtaa

KEGG   Oryctolagus cuniculus (rabbit): 100343144
Entry
100343144         CDS       T03373                                 

Gene name
Orcu-DQA, RLA-DQA
Definition
(RefSeq) SLA class II histocompatibility antigen, DQ haplotype D alpha chain
  KO
K06752  MHC class II antigen
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04145  Phagosome
ocu04514  Cell adhesion molecules
ocu04612  Antigen processing and presentation
ocu04640  Hematopoietic cell lineage
ocu04658  Th1 and Th2 cell differentiation
ocu04659  Th17 cell differentiation
ocu04672  Intestinal immune network for IgA production
ocu04940  Type I diabetes mellitus
ocu05140  Leishmaniasis
ocu05145  Toxoplasmosis
ocu05150  Staphylococcus aureus infection
ocu05152  Tuberculosis
ocu05164  Influenza A
ocu05166  Human T-cell leukemia virus 1 infection
ocu05168  Herpes simplex virus 1 infection
ocu05169  Epstein-Barr virus infection
ocu05310  Asthma
ocu05320  Autoimmune thyroid disease
ocu05321  Inflammatory bowel disease
ocu05322  Systemic lupus erythematosus
ocu05323  Rheumatoid arthritis
ocu05330  Allograft rejection
ocu05332  Graft-versus-host disease
ocu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100343144 (Orcu-DQA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100343144 (Orcu-DQA)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100343144 (Orcu-DQA)
   04612 Antigen processing and presentation
    100343144 (Orcu-DQA)
   04658 Th1 and Th2 cell differentiation
    100343144 (Orcu-DQA)
   04659 Th17 cell differentiation
    100343144 (Orcu-DQA)
   04672 Intestinal immune network for IgA production
    100343144 (Orcu-DQA)
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    100343144 (Orcu-DQA)
   05322 Systemic lupus erythematosus
    100343144 (Orcu-DQA)
   05323 Rheumatoid arthritis
    100343144 (Orcu-DQA)
   05320 Autoimmune thyroid disease
    100343144 (Orcu-DQA)
   05321 Inflammatory bowel disease
    100343144 (Orcu-DQA)
   05330 Allograft rejection
    100343144 (Orcu-DQA)
   05332 Graft-versus-host disease
    100343144 (Orcu-DQA)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100343144 (Orcu-DQA)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100343144 (Orcu-DQA)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    100343144 (Orcu-DQA)
   05152 Tuberculosis
    100343144 (Orcu-DQA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100343144 (Orcu-DQA)
   05164 Influenza A
    100343144 (Orcu-DQA)
   05168 Herpes simplex virus 1 infection
    100343144 (Orcu-DQA)
   05169 Epstein-Barr virus infection
    100343144 (Orcu-DQA)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100343144 (Orcu-DQA)
   05140 Leishmaniasis
    100343144 (Orcu-DQA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ocu04147]
    100343144 (Orcu-DQA)
Exosome [BR:ocu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100343144 (Orcu-DQA)
  Exosomal proteins of epithelial cells
   100343144 (Orcu-DQA)
  Exosomal proteins of breast milk
   100343144 (Orcu-DQA)
SSDB
Motif
Pfam: MHC_II_alpha C1-set Marek_A Ig_3 C2-set_2 SKG6
Other DBs
NCBI-GeneID: 100343144
NCBI-ProteinID: XP_002714556
Ensembl: ENSOCUG00000002480
UniProt: G1SHN0
LinkDB
Position
12
AA seq 255 aa
MIPNKALILAALALTTMMSPCRAEDIVADHVGSYGINVYQSYGPSGQYTHEFDGDEQFYV
DLDKKETIWRLSEFSRFASFDPQGALGNIATAKYNLDIIIKRSNSTAAVNKVPEVTVFSK
APVRLGQPNTLICLVDNIFPPVINISWLINGHPVTEGVFETSFLSKSDHTFFKIGYLTFL
PSADDIYDCRVEHWGLEKPLLRHWEPEIPAPMSELTETVVCALGLAVGLVGIIVGTILII
RGLRSGGASRQQGPL
NT seq 768 nt   +upstreamnt  +downstreamnt
atgattcccaacaaagcactgatcctggcggcccttgccctgaccaccatgatgagcccg
tgcagagctgaggacattgtggctgaccacgttggctcctatggcataaacgtctaccag
tcttatggtccctctggccagtacacccatgaatttgatggagatgagcagttctatgta
gacctggataagaaggagactatctggaggctttctgagtttagcagatttgcaagtttt
gatccacagggtgcactgggaaacatagccacagcaaaatacaacttggacatcataatt
aaacgctccaactctactgctgctgtcaataaagttcctgaggtaacagtgttctccaag
gcccctgtgaggctggggcagcccaacaccctcatctgtcttgtggacaacatctttcct
cctgtgatcaacatctcgtggttgatcaatgggcacccagtcacagaaggtgtttttgag
accagcttcctctccaagagtgatcacaccttcttcaaaatcggctacctcaccttcctc
ccttctgctgatgatatttacgactgcagagtggagcactggggcctggagaagccactt
ctgagacactgggaacctgagatcccagcccccatgtcagagctgacagagactgtggtc
tgcgccctggggttggctgtgggcctcgtgggcatcatagtaggcaccatcctcatcatc
cgaggactgcgctcaggtggtgcctcccgacagcaaggacccttgtga

KEGG   Oryctolagus cuniculus (rabbit): 100348904
Entry
100348904         CDS       T03373                                 

Gene name
RLA-DRB1
Definition
(RefSeq) HLA class II histocompatibility antigen, DRB1-8 beta chain
  KO
K06752  MHC class II antigen
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04145  Phagosome
ocu04514  Cell adhesion molecules
ocu04612  Antigen processing and presentation
ocu04640  Hematopoietic cell lineage
ocu04658  Th1 and Th2 cell differentiation
ocu04659  Th17 cell differentiation
ocu04672  Intestinal immune network for IgA production
ocu04940  Type I diabetes mellitus
ocu05140  Leishmaniasis
ocu05145  Toxoplasmosis
ocu05150  Staphylococcus aureus infection
ocu05152  Tuberculosis
ocu05164  Influenza A
ocu05166  Human T-cell leukemia virus 1 infection
ocu05168  Herpes simplex virus 1 infection
ocu05169  Epstein-Barr virus infection
ocu05310  Asthma
ocu05320  Autoimmune thyroid disease
ocu05321  Inflammatory bowel disease
ocu05322  Systemic lupus erythematosus
ocu05323  Rheumatoid arthritis
ocu05330  Allograft rejection
ocu05332  Graft-versus-host disease
ocu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100348904 (RLA-DRB1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100348904 (RLA-DRB1)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100348904 (RLA-DRB1)
   04612 Antigen processing and presentation
    100348904 (RLA-DRB1)
   04658 Th1 and Th2 cell differentiation
    100348904 (RLA-DRB1)
   04659 Th17 cell differentiation
    100348904 (RLA-DRB1)
   04672 Intestinal immune network for IgA production
    100348904 (RLA-DRB1)
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    100348904 (RLA-DRB1)
   05322 Systemic lupus erythematosus
    100348904 (RLA-DRB1)
   05323 Rheumatoid arthritis
    100348904 (RLA-DRB1)
   05320 Autoimmune thyroid disease
    100348904 (RLA-DRB1)
   05321 Inflammatory bowel disease
    100348904 (RLA-DRB1)
   05330 Allograft rejection
    100348904 (RLA-DRB1)
   05332 Graft-versus-host disease
    100348904 (RLA-DRB1)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100348904 (RLA-DRB1)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100348904 (RLA-DRB1)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    100348904 (RLA-DRB1)
   05152 Tuberculosis
    100348904 (RLA-DRB1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100348904 (RLA-DRB1)
   05164 Influenza A
    100348904 (RLA-DRB1)
   05168 Herpes simplex virus 1 infection
    100348904 (RLA-DRB1)
   05169 Epstein-Barr virus infection
    100348904 (RLA-DRB1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100348904 (RLA-DRB1)
   05140 Leishmaniasis
    100348904 (RLA-DRB1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ocu04147]
    100348904 (RLA-DRB1)
Exosome [BR:ocu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100348904 (RLA-DRB1)
  Exosomal proteins of epithelial cells
   100348904 (RLA-DRB1)
  Exosomal proteins of breast milk
   100348904 (RLA-DRB1)
SSDB
Motif
Pfam: MHC_II_beta C1-set Ig_3 ig Ig_2 DUF1935 Marek_A DUF202
Other DBs
NCBI-GeneID: 100348904
NCBI-ProteinID: XP_008260975
LinkDB
Position
12
AA seq 257 aa
MLWLWLPGASCMAALPATLMVLNLPLALARGRQPRFLEQVKGECYFYNGTQQVRFIVRVI
FNHEEYARFDSYVGEFRPVNELGRQSAAYWNRQKDFLERTRAAVDRCRINYEVVEPFAVP
RRVVPKVTVYPAKTQPLQHHNLLVCAVSGFYPGHIEVRWFRNGEEEEAGVVSTGLIRNGD
WTFQTLVMLETVPQSGEVYTCQVEHPSVTSPITVEWRAQSGSAQSKMLSGIVASVMGLLF
LGLGLFTYFGTQRGCLG
NT seq 774 nt   +upstreamnt  +downstreamnt
atgctgtggctgtggttacctggagcctcctgcatggcagctctcccagcgacactgatg
gtgctgaaccttcccctagctttggccaggggccgccagcctcgcttcctggagcaggtg
aaaggcgagtgctatttctacaacgggacgcagcaggtgcggtttatagtcagagtcata
tttaaccacgaggagtacgcacgcttcgacagctacgtaggggagttccgccccgtcaac
gagctgggacgccagtcagccgcctactggaaccggcagaaggatttcctggagcggacg
cgggctgcggtggaccgatgcaggatcaactacgaggttgtggagcccttcgcggtgccg
cggcgggttgtgccgaaggtgaccgtgtaccctgcaaagacccagcccctgcagcaccac
aacctcctggtctgcgctgtgagtggtttctatccaggccacattgaagtgcggtggttc
cggaatggagaggaagaggaggctggggtggtgtccacgggcctgatccgtaatggagac
tggaccttccagaccctggtgatgcttgagacagttcctcagagtggagaggtgtacacg
tgccaggtggagcacccgagcgtgaccagccccatcaccgtggaatggagggcacagtct
ggatctgcacagagcaagatgctgagtggaattgtggcctctgtgatgggtctactcttc
ctggggctgggtctgtttacctactttgggactcagagaggatgcctgggatga

KEGG   Oryctolagus cuniculus (rabbit): 100349408
Entry
100349408         CDS       T03373                                 

Definition
(RefSeq) HLA class II histocompatibility antigen, DRB1-1 beta chain
  KO
K06752  MHC class II antigen
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04145  Phagosome
ocu04514  Cell adhesion molecules
ocu04612  Antigen processing and presentation
ocu04640  Hematopoietic cell lineage
ocu04658  Th1 and Th2 cell differentiation
ocu04659  Th17 cell differentiation
ocu04672  Intestinal immune network for IgA production
ocu04940  Type I diabetes mellitus
ocu05140  Leishmaniasis
ocu05145  Toxoplasmosis
ocu05150  Staphylococcus aureus infection
ocu05152  Tuberculosis
ocu05164  Influenza A
ocu05166  Human T-cell leukemia virus 1 infection
ocu05168  Herpes simplex virus 1 infection
ocu05169  Epstein-Barr virus infection
ocu05310  Asthma
ocu05320  Autoimmune thyroid disease
ocu05321  Inflammatory bowel disease
ocu05322  Systemic lupus erythematosus
ocu05323  Rheumatoid arthritis
ocu05330  Allograft rejection
ocu05332  Graft-versus-host disease
ocu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100349408
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100349408
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100349408
   04612 Antigen processing and presentation
    100349408
   04658 Th1 and Th2 cell differentiation
    100349408
   04659 Th17 cell differentiation
    100349408
   04672 Intestinal immune network for IgA production
    100349408
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    100349408
   05322 Systemic lupus erythematosus
    100349408
   05323 Rheumatoid arthritis
    100349408
   05320 Autoimmune thyroid disease
    100349408
   05321 Inflammatory bowel disease
    100349408
   05330 Allograft rejection
    100349408
   05332 Graft-versus-host disease
    100349408
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100349408
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100349408
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    100349408
   05152 Tuberculosis
    100349408
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100349408
   05164 Influenza A
    100349408
   05168 Herpes simplex virus 1 infection
    100349408
   05169 Epstein-Barr virus infection
    100349408
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100349408
   05140 Leishmaniasis
    100349408
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ocu04147]
    100349408
Exosome [BR:ocu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100349408
  Exosomal proteins of epithelial cells
   100349408
  Exosomal proteins of breast milk
   100349408
SSDB
Motif
Pfam: MHC_II_beta C1-set Ig_3 MHC_I ig Ig_2 DUF202 Marek_A
Other DBs
NCBI-GeneID: 100349408
NCBI-ProteinID: XP_017200504
LinkDB
Position
12
AA seq 258 aa
MLWLWLPGASCMAALPATLMVLNLPLALARGHQPRFTLQAKGECRFSNGTQRVRLLARFI
YNREEYVRFDSDVGEFLALTELGRPDAEGWNRQEVTLDKYRAAVDTYCVHNYRAFERFAV
PRRVVPTVTVYPAKTQPLQHHNLLVCAVSGFYPGHIEVRWFRNGEEEEAGVVSTGLIRNG
DWTFQTLVMLETVPQSGEVYTCQVEHPSVTSPITVEWRAQAESTQSKLLSGAAGFVLGLL
FLGLGLFIYCRTQRGPLS
NT seq 777 nt   +upstreamnt  +downstreamnt
atgctgtggctgtggttacctggagcctcctgcatggcagctctcccagcgacactgatg
gtgctgaaccttcccctagctttggccaggggtcaccagcctcgtttcaccctgcaggct
aaaggtgagtgtcgtttctccaatgggacgcagcgggtgcggctcctggccagattcatc
tacaaccgggaggagtacgtgcgcttcgatagcgatgtgggtgagttcctcgccctcacg
gagctgggtcggccggatgccgagggctggaaccggcaggaggtcacactggacaagtat
cgggccgcggtggacacgtactgcgtacacaactaccgtgcctttgagcgcttcgcggtg
ccgcggcgagttgtgccgacggtgaccgtgtaccctgcaaagacgcagcccctgcagcac
cacaacctcctggtctgcgctgtgagtggcttctatccaggccacattgaagtgcggtgg
ttccggaatggagaggaagaggaggctggggtggtgtccacgggcctgatccgtaatgga
gactggaccttccagaccctggtgatgcttgagacagttcctcagagtggagaggtgtac
acgtgccaggtggagcacccgagcgtgaccagccccatcaccgtggaatggagggcacag
gctgaatccacacagagcaagttgctgagtggagctgcgggctttgtgctgggtctgctg
tttcttggactggggctgttcatctactgcaggactcagagaggacccctgagctga

KEGG   Oryctolagus cuniculus (rabbit): 100349667
Entry
100349667         CDS       T03373                                 

Definition
(RefSeq) HLA class II histocompatibility antigen, DRB1-1 beta chain
  KO
K06752  MHC class II antigen
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04145  Phagosome
ocu04514  Cell adhesion molecules
ocu04612  Antigen processing and presentation
ocu04640  Hematopoietic cell lineage
ocu04658  Th1 and Th2 cell differentiation
ocu04659  Th17 cell differentiation
ocu04672  Intestinal immune network for IgA production
ocu04940  Type I diabetes mellitus
ocu05140  Leishmaniasis
ocu05145  Toxoplasmosis
ocu05150  Staphylococcus aureus infection
ocu05152  Tuberculosis
ocu05164  Influenza A
ocu05166  Human T-cell leukemia virus 1 infection
ocu05168  Herpes simplex virus 1 infection
ocu05169  Epstein-Barr virus infection
ocu05310  Asthma
ocu05320  Autoimmune thyroid disease
ocu05321  Inflammatory bowel disease
ocu05322  Systemic lupus erythematosus
ocu05323  Rheumatoid arthritis
ocu05330  Allograft rejection
ocu05332  Graft-versus-host disease
ocu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100349667
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100349667
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100349667
   04612 Antigen processing and presentation
    100349667
   04658 Th1 and Th2 cell differentiation
    100349667
   04659 Th17 cell differentiation
    100349667
   04672 Intestinal immune network for IgA production
    100349667
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    100349667
   05322 Systemic lupus erythematosus
    100349667
   05323 Rheumatoid arthritis
    100349667
   05320 Autoimmune thyroid disease
    100349667
   05321 Inflammatory bowel disease
    100349667
   05330 Allograft rejection
    100349667
   05332 Graft-versus-host disease
    100349667
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100349667
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100349667
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    100349667
   05152 Tuberculosis
    100349667
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100349667
   05164 Influenza A
    100349667
   05168 Herpes simplex virus 1 infection
    100349667
   05169 Epstein-Barr virus infection
    100349667
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100349667
   05140 Leishmaniasis
    100349667
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ocu04147]
    100349667
Exosome [BR:ocu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100349667
  Exosomal proteins of epithelial cells
   100349667
  Exosomal proteins of breast milk
   100349667
SSDB
Motif
Pfam: MHC_II_beta C1-set Ig_3 Ig_2 ig Marek_A DUF202 MHC_I
Other DBs
NCBI-GeneID: 100349667
NCBI-ProteinID: XP_008260977
UniProt: U3KMS9
LinkDB
Position
12
AA seq 255 aa
MLCPWLSRGPCLAALTVTLLVLSPTPALAGDLLSRFMLQMKYECHFSNGTQRVRYVERHF
YNREETLRFDSDVGEFRALTELGRPEADAWNQREDRLEDRRAAVDTFCRYNYLALESFAG
RRRVVPKVTVYPAKTQPLQHHNLLVCAVSGFYPGHIEVRWFRNGEEEEAGVVSTGLICNG
DWTFQTLVMLETVPQSGEVYTCQVEHPSVTSPITVEWRVQSESAHSKQLSGIGGVVLGLF
FLGVGLFIYCRTQKV
NT seq 768 nt   +upstreamnt  +downstreamnt
atgctgtgtccttggctctcccgaggcccctgcctggcagctctgactgtgacactgctg
gtgctgagccccaccccggctttggctggggacctcctatcccgtttcatgctgcagatg
aagtatgagtgtcatttctccaacgggacgcagcgggtgcggtacgtggagaggcacttc
tacaaccgggaggagaccctgcgcttcgacagcgacgtgggggagttcagggcgctgacg
gagctgggccggccggaggcggatgcctggaaccagcgcgaggacagactggaggacagg
agggccgcggtggacacgttttgcagatacaactacctggcgctggagagcttcgctggg
cggcggcgagttgtgccgaaggtgaccgtgtaccctgcaaagacgcagcccctgcagcac
cacaacctcctggtctgcgctgtgagtggcttctatccaggccacattgaagtgcggtgg
ttccggaatggagaggaagaggaggctggggtggtgtccacaggcctgatctgtaatgga
gactggaccttccagaccctggtgatgcttgagacagttcctcagagtggagaggtgtac
acgtgccaggtggagcacccgagcgtgaccagccccatcaccgtggaatggagggtacag
tcggaatctgctcacagcaagcagctgagtggaattgggggcgtggtgctgggtctgttc
ttcctgggtgtggggctgttcatctactgcaggactcagaaggtgtga

KEGG   Oryctolagus cuniculus (rabbit): 100350168
Entry
100350168         CDS       T03373                                 

Gene name
Orcu-DRB
Definition
(RefSeq) HLA class II histocompatibility antigen, DRB1-4 beta chain
  KO
K06752  MHC class II antigen
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04145  Phagosome
ocu04514  Cell adhesion molecules
ocu04612  Antigen processing and presentation
ocu04640  Hematopoietic cell lineage
ocu04658  Th1 and Th2 cell differentiation
ocu04659  Th17 cell differentiation
ocu04672  Intestinal immune network for IgA production
ocu04940  Type I diabetes mellitus
ocu05140  Leishmaniasis
ocu05145  Toxoplasmosis
ocu05150  Staphylococcus aureus infection
ocu05152  Tuberculosis
ocu05164  Influenza A
ocu05166  Human T-cell leukemia virus 1 infection
ocu05168  Herpes simplex virus 1 infection
ocu05169  Epstein-Barr virus infection
ocu05310  Asthma
ocu05320  Autoimmune thyroid disease
ocu05321  Inflammatory bowel disease
ocu05322  Systemic lupus erythematosus
ocu05323  Rheumatoid arthritis
ocu05330  Allograft rejection
ocu05332  Graft-versus-host disease
ocu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100350168 (Orcu-DRB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100350168 (Orcu-DRB)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100350168 (Orcu-DRB)
   04612 Antigen processing and presentation
    100350168 (Orcu-DRB)
   04658 Th1 and Th2 cell differentiation
    100350168 (Orcu-DRB)
   04659 Th17 cell differentiation
    100350168 (Orcu-DRB)
   04672 Intestinal immune network for IgA production
    100350168 (Orcu-DRB)
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    100350168 (Orcu-DRB)
   05322 Systemic lupus erythematosus
    100350168 (Orcu-DRB)
   05323 Rheumatoid arthritis
    100350168 (Orcu-DRB)
   05320 Autoimmune thyroid disease
    100350168 (Orcu-DRB)
   05321 Inflammatory bowel disease
    100350168 (Orcu-DRB)
   05330 Allograft rejection
    100350168 (Orcu-DRB)
   05332 Graft-versus-host disease
    100350168 (Orcu-DRB)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100350168 (Orcu-DRB)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100350168 (Orcu-DRB)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    100350168 (Orcu-DRB)
   05152 Tuberculosis
    100350168 (Orcu-DRB)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100350168 (Orcu-DRB)
   05164 Influenza A
    100350168 (Orcu-DRB)
   05168 Herpes simplex virus 1 infection
    100350168 (Orcu-DRB)
   05169 Epstein-Barr virus infection
    100350168 (Orcu-DRB)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100350168 (Orcu-DRB)
   05140 Leishmaniasis
    100350168 (Orcu-DRB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ocu04147]
    100350168 (Orcu-DRB)
Exosome [BR:ocu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100350168 (Orcu-DRB)
  Exosomal proteins of epithelial cells
   100350168 (Orcu-DRB)
  Exosomal proteins of breast milk
   100350168 (Orcu-DRB)
SSDB
Motif
Pfam: MHC_II_beta C1-set Ig_3 ig Ig_2 DUF202
Other DBs
NCBI-GeneID: 100350168
NCBI-ProteinID: XP_008260978
UniProt: A0A5F9DUW7
LinkDB
Position
12
AA seq 266 aa
MLCLWLLRSSCLAALTVTLLVLRSPLSLARDTRPRFMQQVKHECHFSNGMQRVRFLDGHL
YNREEYVRFDSDVGEYRAVTELGRLDAEYWNSQTDRLDYKRGQVDTYCRYNYGVVDSFLV
QRRVVPTVTVYPAKTQPLQHHNLLVCAVSGFYPGHIEVRWFRNGEEEEAGVVSTGLIRNG
DWTFQTLVMLETVPQSGEVYTCQVEHPSVTSPITVEWRAQSESAQSKMLSGVGGFVLALL
FLGLGLFVYRRNQKGHSRQQPRGLLS
NT seq 801 nt   +upstreamnt  +downstreamnt
atgctgtgtctgtggctcctcagaagctcctgcctggcggctctgactgtgacactgctt
gttctgcgctctcctttgtctctggccagggacaccagaccccgtttcatgcagcaagtt
aaacatgagtgtcatttctccaacgggatgcagcgggtgcggttcctggatggacactta
tacaaccgggaggaatacgtgcgcttcgacagcgacgtgggcgaatacagggcggtgacc
gagctgggccggctggacgccgagtactggaacagccagacggacagactggactacaaa
cgcggccaggtggacacatactgcagatacaactatggggttgtggacagcttcctggtg
cagcggcgagttgtgccgacggtgaccgtgtaccctgcaaagacgcagcccctgcagcac
cacaacctcctggtctgcgctgtgagtggcttctatccaggccacattgaagtgcgatgg
ttccggaatggagaggaagaggaggctggggtggtgtccacgggcctgatccgtaatgga
gactggaccttccagaccctggtgatgcttgagacagttcctcagagtggagaggtgtac
acgtgccaggtggagcacccgagcgtgaccagccccatcaccgtggaatggagggcacag
tctgaatccgcacaaagcaagatgctgagtggagtcgggggctttgtgctggctctgctc
ttccttgggctggggttgtttgtctaccgcaggaatcagaaaggacactctagacagcag
ccaagaggtctcctgagctga

KEGG   Oryctolagus cuniculus (rabbit): 100350656
Entry
100350656         CDS       T03373                                 

Gene name
RLA-DRB1, Orcu-DRB
Definition
(RefSeq) HLA class II histocompatibility antigen, DRB1-4 beta chain
  KO
K06752  MHC class II antigen
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04145  Phagosome
ocu04514  Cell adhesion molecules
ocu04612  Antigen processing and presentation
ocu04640  Hematopoietic cell lineage
ocu04658  Th1 and Th2 cell differentiation
ocu04659  Th17 cell differentiation
ocu04672  Intestinal immune network for IgA production
ocu04940  Type I diabetes mellitus
ocu05140  Leishmaniasis
ocu05145  Toxoplasmosis
ocu05150  Staphylococcus aureus infection
ocu05152  Tuberculosis
ocu05164  Influenza A
ocu05166  Human T-cell leukemia virus 1 infection
ocu05168  Herpes simplex virus 1 infection
ocu05169  Epstein-Barr virus infection
ocu05310  Asthma
ocu05320  Autoimmune thyroid disease
ocu05321  Inflammatory bowel disease
ocu05322  Systemic lupus erythematosus
ocu05323  Rheumatoid arthritis
ocu05330  Allograft rejection
ocu05332  Graft-versus-host disease
ocu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100350656 (RLA-DRB1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100350656 (RLA-DRB1)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100350656 (RLA-DRB1)
   04612 Antigen processing and presentation
    100350656 (RLA-DRB1)
   04658 Th1 and Th2 cell differentiation
    100350656 (RLA-DRB1)
   04659 Th17 cell differentiation
    100350656 (RLA-DRB1)
   04672 Intestinal immune network for IgA production
    100350656 (RLA-DRB1)
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    100350656 (RLA-DRB1)
   05322 Systemic lupus erythematosus
    100350656 (RLA-DRB1)
   05323 Rheumatoid arthritis
    100350656 (RLA-DRB1)
   05320 Autoimmune thyroid disease
    100350656 (RLA-DRB1)
   05321 Inflammatory bowel disease
    100350656 (RLA-DRB1)
   05330 Allograft rejection
    100350656 (RLA-DRB1)
   05332 Graft-versus-host disease
    100350656 (RLA-DRB1)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100350656 (RLA-DRB1)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100350656 (RLA-DRB1)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    100350656 (RLA-DRB1)
   05152 Tuberculosis
    100350656 (RLA-DRB1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100350656 (RLA-DRB1)
   05164 Influenza A
    100350656 (RLA-DRB1)
   05168 Herpes simplex virus 1 infection
    100350656 (RLA-DRB1)
   05169 Epstein-Barr virus infection
    100350656 (RLA-DRB1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100350656 (RLA-DRB1)
   05140 Leishmaniasis
    100350656 (RLA-DRB1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ocu04147]
    100350656 (RLA-DRB1)
Exosome [BR:ocu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100350656 (RLA-DRB1)
  Exosomal proteins of epithelial cells
   100350656 (RLA-DRB1)
  Exosomal proteins of breast milk
   100350656 (RLA-DRB1)
SSDB
Motif
Pfam: MHC_II_beta C1-set Ig_3 ig Ig_2 DUF202 Marek_A
Other DBs
NCBI-GeneID: 100350656
NCBI-ProteinID: XP_002714652
Ensembl: ENSOCUG00000001396
UniProt: G1SFC3
LinkDB
Position
12
AA seq 266 aa
MLCLWLSRGPCLAALTVTLLVLSSYLALARDTRSRFLELVKHECHFSNGTQRVRYIFRDV
YNQEEHVRFDSDVGEFEAVTELGRPDAEYWNSQTDILEDRRTAVDRYCRHNYGVLDSFLV
QRRVVPTVTVYPAKTQPLQHHNLLVCAVSGFYPGHIEVRWFRNGEEEEAGVVSTGLIRNG
DWTFQTLVMLETVPQSGEVYTCQVEHPSVTSPITVEWKAQSESAQSKMLSGVGGFVLGLL
FLGLGLFVYRRNQKGHSGLQPTGLLS
NT seq 801 nt   +upstreamnt  +downstreamnt
atgctgtgtctgtggctctcccgaggcccctgcctggcagctctgactgtgacactgctg
gtgctgagctcttacctggctttggccagggacacccgatcccgtttcctggagctggtt
aaacatgagtgtcatttctccaacgggacgcagcgggtgcggtatatattcagagacgtt
tataaccaggaagagcacgtgcgctttgacagcgatgtgggcgagttcgaagcagtgaca
gaactgggccggccggacgccgagtactggaacagccagacggacatcctggaggacagg
cggaccgcggtggacaggtactgcagacacaactacggggttctggacagcttcctggtg
cagcggcgagttgtgccgacggtgaccgtgtaccctgcaaagacccagcccctgcagcac
cacaacctcctggtctgtgctgtgagtggcttctatccaggccacattgaagtgcggtgg
ttccggaatggagaggaagaggaggctggggtggtgtccacgggcctgatccgtaatgga
gactggaccttccagaccctggtgatgcttgagacagttcctcagagtggagaggtgtac
acgtgccaggtggagcacccgagcgtgaccagccccatcaccgtggaatggaaggcacag
tctgaatccgcacagagcaagatgctgagtggagtcgggggctttgtgctgggtctgctc
ttcctcgggctggggctctttgtctaccgcaggaatcagaaagggcactctggacttcag
cccacagggctcctgagctga

KEGG   Oryctolagus cuniculus (rabbit): 100351163
Entry
100351163         CDS       T03373                                 

Gene name
RLA-DQB, RLA-DQB1
Definition
(RefSeq) HLA class II histocompatibility antigen, DQ beta 1 chain
  KO
K06752  MHC class II antigen
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04145  Phagosome
ocu04514  Cell adhesion molecules
ocu04612  Antigen processing and presentation
ocu04640  Hematopoietic cell lineage
ocu04658  Th1 and Th2 cell differentiation
ocu04659  Th17 cell differentiation
ocu04672  Intestinal immune network for IgA production
ocu04940  Type I diabetes mellitus
ocu05140  Leishmaniasis
ocu05145  Toxoplasmosis
ocu05150  Staphylococcus aureus infection
ocu05152  Tuberculosis
ocu05164  Influenza A
ocu05166  Human T-cell leukemia virus 1 infection
ocu05168  Herpes simplex virus 1 infection
ocu05169  Epstein-Barr virus infection
ocu05310  Asthma
ocu05320  Autoimmune thyroid disease
ocu05321  Inflammatory bowel disease
ocu05322  Systemic lupus erythematosus
ocu05323  Rheumatoid arthritis
ocu05330  Allograft rejection
ocu05332  Graft-versus-host disease
ocu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100351163 (RLA-DQB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100351163 (RLA-DQB)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100351163 (RLA-DQB)
   04612 Antigen processing and presentation
    100351163 (RLA-DQB)
   04658 Th1 and Th2 cell differentiation
    100351163 (RLA-DQB)
   04659 Th17 cell differentiation
    100351163 (RLA-DQB)
   04672 Intestinal immune network for IgA production
    100351163 (RLA-DQB)
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    100351163 (RLA-DQB)
   05322 Systemic lupus erythematosus
    100351163 (RLA-DQB)
   05323 Rheumatoid arthritis
    100351163 (RLA-DQB)
   05320 Autoimmune thyroid disease
    100351163 (RLA-DQB)
   05321 Inflammatory bowel disease
    100351163 (RLA-DQB)
   05330 Allograft rejection
    100351163 (RLA-DQB)
   05332 Graft-versus-host disease
    100351163 (RLA-DQB)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100351163 (RLA-DQB)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100351163 (RLA-DQB)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    100351163 (RLA-DQB)
   05152 Tuberculosis
    100351163 (RLA-DQB)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100351163 (RLA-DQB)
   05164 Influenza A
    100351163 (RLA-DQB)
   05168 Herpes simplex virus 1 infection
    100351163 (RLA-DQB)
   05169 Epstein-Barr virus infection
    100351163 (RLA-DQB)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100351163 (RLA-DQB)
   05140 Leishmaniasis
    100351163 (RLA-DQB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ocu04147]
    100351163 (RLA-DQB)
Exosome [BR:ocu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100351163 (RLA-DQB)
  Exosomal proteins of epithelial cells
   100351163 (RLA-DQB)
  Exosomal proteins of breast milk
   100351163 (RLA-DQB)
SSDB
Motif
Pfam: MHC_II_beta C1-set Ig_3 ig C2-set_2 Ig_2
Other DBs
NCBI-GeneID: 100351163
NCBI-ProteinID: XP_008260979
Ensembl: ENSOCUG00000002485
LinkDB
Position
12
AA seq 269 aa
MSRGMALLLPRSLRRAAVLAILVVLSSPAAEGHDSPKDFVVQFKCQCYFTNGTQRVQYVT
RYIYNLEEHLRFDSDVGEYRAVTELGRPEAKSWNSQPDILERTRAEVDTVCRHNYQAELL
TSLQRREKPMVTISPSKREVLDHHNMLVCSVTDFYPSQIKVRWFRNDQEETAGVVSTPLI
RNGDWTFQILVMLEMTPQRGDVYTCQVEHPSVESPITVEWRVQSESAQSKMLSGVGGFVL
GLIFLGLGLIIHHRSQKGSRGSPPTGLLH
NT seq 810 nt   +upstreamnt  +downstreamnt
atgtctcgggggatggcgctgctgcttcccagaagccttcgtagagcagctgtgctggcg
atcctggtggtgctgagctcccctgcggcagagggccacgactccccaaaggatttcgtg
gtccagtttaagtgtcagtgctacttcaccaacgggacgcagcgggtgcagtacgtgacc
agatacatctacaacctggaggagcacctgcgcttcgacagcgacgtgggcgagtaccgg
gcggtgaccgagctgggccggccggaggccaagtcctggaacagccagccggacatcctg
gagcggacgcgcgccgaggtagacacggtctgcagacacaactaccaggcagagctcctc
acctccttacagcggcgagagaagcctatggtgaccatctccccgtcgaagagagaggtt
ctggaccaccacaacatgctggtctgctcagtgacagatttctaccccagccagatcaaa
gttcgctggtttcggaatgaccaggaggagacagctggcgttgtgtccacccctcttatt
aggaatggggactggaccttccagattctggtgatgctggaaatgactccccagcgagga
gatgtctacacctgccaagtggagcaccccagcgtcgagagccccatcacggtggagtgg
cgggtgcagtctgaatctgcccagagcaagatgctgagtggcgtcgggggcttcgtgctg
gggctgatcttcctcgggctgggccttatcatccatcacaggagtcagaaaggatctcgt
gggtctccaccaacagggctcctgcactga

KEGG   Oryctolagus cuniculus (rabbit): 100351416
Entry
100351416         CDS       T03373                                 

Definition
(RefSeq) HLA class II histocompatibility antigen, DO beta chain
  KO
K06752  MHC class II antigen
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04145  Phagosome
ocu04514  Cell adhesion molecules
ocu04612  Antigen processing and presentation
ocu04640  Hematopoietic cell lineage
ocu04658  Th1 and Th2 cell differentiation
ocu04659  Th17 cell differentiation
ocu04672  Intestinal immune network for IgA production
ocu04940  Type I diabetes mellitus
ocu05140  Leishmaniasis
ocu05145  Toxoplasmosis
ocu05150  Staphylococcus aureus infection
ocu05152  Tuberculosis
ocu05164  Influenza A
ocu05166  Human T-cell leukemia virus 1 infection
ocu05168  Herpes simplex virus 1 infection
ocu05169  Epstein-Barr virus infection
ocu05310  Asthma
ocu05320  Autoimmune thyroid disease
ocu05321  Inflammatory bowel disease
ocu05322  Systemic lupus erythematosus
ocu05323  Rheumatoid arthritis
ocu05330  Allograft rejection
ocu05332  Graft-versus-host disease
ocu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100351416
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100351416
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100351416
   04612 Antigen processing and presentation
    100351416
   04658 Th1 and Th2 cell differentiation
    100351416
   04659 Th17 cell differentiation
    100351416
   04672 Intestinal immune network for IgA production
    100351416
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    100351416
   05322 Systemic lupus erythematosus
    100351416
   05323 Rheumatoid arthritis
    100351416
   05320 Autoimmune thyroid disease
    100351416
   05321 Inflammatory bowel disease
    100351416
   05330 Allograft rejection
    100351416
   05332 Graft-versus-host disease
    100351416
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100351416
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100351416
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    100351416
   05152 Tuberculosis
    100351416
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100351416
   05164 Influenza A
    100351416
   05168 Herpes simplex virus 1 infection
    100351416
   05169 Epstein-Barr virus infection
    100351416
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100351416
   05140 Leishmaniasis
    100351416
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ocu04147]
    100351416
Exosome [BR:ocu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100351416
  Exosomal proteins of epithelial cells
   100351416
  Exosomal proteins of breast milk
   100351416
SSDB
Motif
Pfam: MHC_II_beta C1-set Ig_3 C2-set_2 MHC_I
Other DBs
NCBI-GeneID: 100351416
NCBI-ProteinID: XP_008260980
Ensembl: ENSOCUG00000029437
UniProt: G1SHP0
LinkDB
Position
12
AA seq 264 aa
MDSKWVPWVVALLVNLIRLDYSMTQGDSPEDFVIQAKADCYFTNGTEQVRFVVRFIFNLE
EYAHFDSDVGMFVALTELGQPDAESWNNRPDILERSRASVDFLCRRNYRLGAPFTVGRKV
PPEVTVYPERTPVLRQHNLLLCSATGFYPGDIRVKWLRNGQEERAGIMSTGLIRNGDWTF
QTTEMLEMTPELGDVYTCLVDHPSLLSPVSVEWRPQSEYSWAKMLSGVAGFLFGLIFLMV
GTIIHIRAWKGYVETQLSAAAEVS
NT seq 795 nt   +upstreamnt  +downstreamnt
atggattccaagtgggttccctgggtggtggctctgctggtgaatctgatcaggctggat
tactccatgactcaaggagactctccagaagattttgtgattcaggcaaaggctgactgc
tacttcaccaacgggacagagcaggtgcggtttgtggtcaggtttatctttaatttggag
gagtatgcacactttgacagcgacgtggggatgtttgtggcgctgacggagctggggcag
cctgatgctgagtcgtggaacaatcggcccgacatcctggagaggagcagagcgtctgtg
gattttctctgtagacgcaactacaggctgggggctcccttcactgtggggagaaaagtg
ccaccagaggtgacagtgtacccagagaggaccccggtcctgcggcagcacaacctgctg
ctctgctctgcgacgggcttctatccgggggacatcagagtcaagtggctgcggaatggg
caggaggagagagctgggatcatgtccactggccttatcagaaacggagactggaccttt
cagaccacggagatgctggaaatgactcctgagcttggagacgtctacacttgtctcgtg
gatcaccccagcctgctgagccccgtttctgtggagtggaggcctcagtctgaatattct
tgggcaaagatgctaagtggagttgcaggcttcctgtttgggctgatcttccttatggtg
ggaaccatcattcatatcagggcttggaaaggatatgtggagacacagctctctgctgct
gctgaggtctcttag

KEGG   Oryctolagus cuniculus (rabbit): 100352415
Entry
100352415         CDS       T03373                                 

Gene name
RLA-DMA
Definition
(RefSeq) histocompatibility antigen DM heterodimer heavy chain-like
  KO
K06752  MHC class II antigen
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04145  Phagosome
ocu04514  Cell adhesion molecules
ocu04612  Antigen processing and presentation
ocu04640  Hematopoietic cell lineage
ocu04658  Th1 and Th2 cell differentiation
ocu04659  Th17 cell differentiation
ocu04672  Intestinal immune network for IgA production
ocu04940  Type I diabetes mellitus
ocu05140  Leishmaniasis
ocu05145  Toxoplasmosis
ocu05150  Staphylococcus aureus infection
ocu05152  Tuberculosis
ocu05164  Influenza A
ocu05166  Human T-cell leukemia virus 1 infection
ocu05168  Herpes simplex virus 1 infection
ocu05169  Epstein-Barr virus infection
ocu05310  Asthma
ocu05320  Autoimmune thyroid disease
ocu05321  Inflammatory bowel disease
ocu05322  Systemic lupus erythematosus
ocu05323  Rheumatoid arthritis
ocu05330  Allograft rejection
ocu05332  Graft-versus-host disease
ocu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100352415 (RLA-DMA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100352415 (RLA-DMA)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100352415 (RLA-DMA)
   04612 Antigen processing and presentation
    100352415 (RLA-DMA)
   04658 Th1 and Th2 cell differentiation
    100352415 (RLA-DMA)
   04659 Th17 cell differentiation
    100352415 (RLA-DMA)
   04672 Intestinal immune network for IgA production
    100352415 (RLA-DMA)
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    100352415 (RLA-DMA)
   05322 Systemic lupus erythematosus
    100352415 (RLA-DMA)
   05323 Rheumatoid arthritis
    100352415 (RLA-DMA)
   05320 Autoimmune thyroid disease
    100352415 (RLA-DMA)
   05321 Inflammatory bowel disease
    100352415 (RLA-DMA)
   05330 Allograft rejection
    100352415 (RLA-DMA)
   05332 Graft-versus-host disease
    100352415 (RLA-DMA)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100352415 (RLA-DMA)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100352415 (RLA-DMA)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    100352415 (RLA-DMA)
   05152 Tuberculosis
    100352415 (RLA-DMA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100352415 (RLA-DMA)
   05164 Influenza A
    100352415 (RLA-DMA)
   05168 Herpes simplex virus 1 infection
    100352415 (RLA-DMA)
   05169 Epstein-Barr virus infection
    100352415 (RLA-DMA)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100352415 (RLA-DMA)
   05140 Leishmaniasis
    100352415 (RLA-DMA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ocu04147]
    100352415 (RLA-DMA)
Exosome [BR:ocu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100352415 (RLA-DMA)
  Exosomal proteins of epithelial cells
   100352415 (RLA-DMA)
  Exosomal proteins of breast milk
   100352415 (RLA-DMA)
SSDB
Motif
Pfam: MHC_II_alpha C1-set
Other DBs
NCBI-GeneID: 100352415
NCBI-ProteinID: NP_001177361
UniProt: O02872
LinkDB
Position
12
AA seq 258 aa
MDRGQSQGAARLQLLQLLWLLPRSWAGSAVAAPAWRDELQNHTFLHTVFCQMGNPSEGLF
EAYDSDLLFSFDFSQRTRVPRLPEFADWAQDQSDISDILFDRWFCQQLVQNVGPHLDGKI
PVSRGFPIAEVFPLRPLEFGKPNTLVCFISNLFPPMLSVSWQHHLEPVQGAGPTFVSAVD
GLSFQAFSYLNFTPQPSDLYSCIVTHEIDPYTAVVYWLPKNALPSALLENVLCGLAFGLG
VLGIIVGTALIISFRRPC
NT seq 777 nt   +upstreamnt  +downstreamnt
atggatcgtgggcagagccagggggctgcacggctgcaactgctgcagcttctgtggctg
ctgccccgctcctgggccggctctgcagtggctgctccggcctggcgggatgagctgcaa
aaccacacgttcctgcacacggtcttctgccagatggggaatccctctgaggggctcttc
gaagcctatgactcggacctgctcttctccttcgacttttcccagagaacccgtgtgcct
cgcctgcccgaatttgctgactgggcccaggaccagagcgacatctctgacattttgttt
gacagatggttctgccagcagttggtccagaatgtgggcccacatcttgacgggaagatc
ccggtgtcccgaggcttccccatcgcggaggtgttcccgctgaggcccctggagtttggc
aagcccaacacgctggtgtgtttcatcagcaacctcttcccgcccatgctgagcgtgagt
tggcagcaccacttggagccggtgcagggagctgggcccaccttcgtctcggctgtcgat
ggactcagcttccaggccttctcgtacttaaacttcaccccacagccctctgacctttac
tcctgcatcgtgactcacgagatcgacccctacacagcagttgtctactggttgccgaag
aacgcactgccctcggctctcctggagaatgtgctgtgtggcctggcctttggcctgggt
gtgctgggcatcattgtgggcactgccctcatcatctccttccgcaggccttgctaa

KEGG   Oryctolagus cuniculus (rabbit): 100352672
Entry
100352672         CDS       T03373                                 

Definition
(RefSeq) HLA class II histocompatibility antigen, DO alpha chain
  KO
K06752  MHC class II antigen
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04145  Phagosome
ocu04514  Cell adhesion molecules
ocu04612  Antigen processing and presentation
ocu04640  Hematopoietic cell lineage
ocu04658  Th1 and Th2 cell differentiation
ocu04659  Th17 cell differentiation
ocu04672  Intestinal immune network for IgA production
ocu04940  Type I diabetes mellitus
ocu05140  Leishmaniasis
ocu05145  Toxoplasmosis
ocu05150  Staphylococcus aureus infection
ocu05152  Tuberculosis
ocu05164  Influenza A
ocu05166  Human T-cell leukemia virus 1 infection
ocu05168  Herpes simplex virus 1 infection
ocu05169  Epstein-Barr virus infection
ocu05310  Asthma
ocu05320  Autoimmune thyroid disease
ocu05321  Inflammatory bowel disease
ocu05322  Systemic lupus erythematosus
ocu05323  Rheumatoid arthritis
ocu05330  Allograft rejection
ocu05332  Graft-versus-host disease
ocu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100352672
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100352672
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100352672
   04612 Antigen processing and presentation
    100352672
   04658 Th1 and Th2 cell differentiation
    100352672
   04659 Th17 cell differentiation
    100352672
   04672 Intestinal immune network for IgA production
    100352672
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    100352672
   05322 Systemic lupus erythematosus
    100352672
   05323 Rheumatoid arthritis
    100352672
   05320 Autoimmune thyroid disease
    100352672
   05321 Inflammatory bowel disease
    100352672
   05330 Allograft rejection
    100352672
   05332 Graft-versus-host disease
    100352672
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100352672
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100352672
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    100352672
   05152 Tuberculosis
    100352672
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100352672
   05164 Influenza A
    100352672
   05168 Herpes simplex virus 1 infection
    100352672
   05169 Epstein-Barr virus infection
    100352672
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100352672
   05140 Leishmaniasis
    100352672
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ocu04147]
    100352672
Exosome [BR:ocu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100352672
  Exosomal proteins of epithelial cells
   100352672
  Exosomal proteins of breast milk
   100352672
SSDB
Motif
Pfam: MHC_II_alpha C1-set Ig_3 Marek_A C2-set_2
Other DBs
NCBI-GeneID: 100352672
NCBI-ProteinID: XP_008260989
UniProt: A0A5F9DE57
LinkDB
Position
12
AA seq 252 aa
MALRAGLVLGLHTLRILLSPKEAGAITADHMGSYGPAFYQSYDASGQFTYEFDGEQLLSV
DLKEKEAVWRLPEFGDLARFDPQGGLAGIAMIQMHLDVLVERSNHTRATSVRPSVTVFPK
SPVELGQPNTLICVVDNIFPPVINISWLRNGETVTLGVTQTSFYSRPDHLFRKFHYLAFV
PSAADVYDCRVEHWGLDAPLLTHWEPQVPTPLPDTTETLVCVLGLAFGLVGFLVGTILII
TGTRMSRAAPRS
NT seq 759 nt   +upstreamnt  +downstreamnt
atggccctccgtgccgggctggtcctgggactgcacaccctgaggatcctcctgagcccg
aaggaagcaggtgccatcacggctgaccacatgggctcctacggaccagccttctaccag
tcttacgatgcctcgggccagttcacctatgagttcgacggggagcagctgctgtccgtg
gacctgaaggaaaaggaggcggtgtggcgtctgcctgagtttggcgacttggcccgcttt
gacccacagggcgggctggctggcattgccatgatccagatgcatctagatgtcttggtg
gaacgctccaaccacaccagagccaccagcgtgcgcccaagcgtgaccgtcttccccaag
tctccagtggagctgggccagcccaacaccctcatctgtgtcgtggacaacatcttcccc
cctgtgatcaacatcagctggctgcgcaatggcgagacggtcaccttgggagtgacccag
accagcttctactcccggcccgaccacttgttccgcaagttccactacctggccttcgtg
ccctccgctgccgacgtctacgactgcagggtggagcactggggcctggacgcgccgctc
ctcacgcactgggagccacaggtgcccaccccactgccagacaccacggagaccctggtc
tgtgtgctgggcctcgccttcggcctggtgggcttccttgtgggcaccatcctcatcatc
actggcacacgcatgtccagagctgcccccaggtcatga

KEGG   Oryctolagus cuniculus (rabbit): 100352927
Entry
100352927         CDS       T03373                                 

Definition
(RefSeq) RLA class II histocompatibility antigen, DP alpha-1 chain
  KO
K06752  MHC class II antigen
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04145  Phagosome
ocu04514  Cell adhesion molecules
ocu04612  Antigen processing and presentation
ocu04640  Hematopoietic cell lineage
ocu04658  Th1 and Th2 cell differentiation
ocu04659  Th17 cell differentiation
ocu04672  Intestinal immune network for IgA production
ocu04940  Type I diabetes mellitus
ocu05140  Leishmaniasis
ocu05145  Toxoplasmosis
ocu05150  Staphylococcus aureus infection
ocu05152  Tuberculosis
ocu05164  Influenza A
ocu05166  Human T-cell leukemia virus 1 infection
ocu05168  Herpes simplex virus 1 infection
ocu05169  Epstein-Barr virus infection
ocu05310  Asthma
ocu05320  Autoimmune thyroid disease
ocu05321  Inflammatory bowel disease
ocu05322  Systemic lupus erythematosus
ocu05323  Rheumatoid arthritis
ocu05330  Allograft rejection
ocu05332  Graft-versus-host disease
ocu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100352927
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100352927
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100352927
   04612 Antigen processing and presentation
    100352927
   04658 Th1 and Th2 cell differentiation
    100352927
   04659 Th17 cell differentiation
    100352927
   04672 Intestinal immune network for IgA production
    100352927
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    100352927
   05322 Systemic lupus erythematosus
    100352927
   05323 Rheumatoid arthritis
    100352927
   05320 Autoimmune thyroid disease
    100352927
   05321 Inflammatory bowel disease
    100352927
   05330 Allograft rejection
    100352927
   05332 Graft-versus-host disease
    100352927
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100352927
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100352927
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    100352927
   05152 Tuberculosis
    100352927
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100352927
   05164 Influenza A
    100352927
   05168 Herpes simplex virus 1 infection
    100352927
   05169 Epstein-Barr virus infection
    100352927
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100352927
   05140 Leishmaniasis
    100352927
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ocu04147]
    100352927
Exosome [BR:ocu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100352927
  Exosomal proteins of epithelial cells
   100352927
  Exosomal proteins of breast milk
   100352927
SSDB
Motif
Pfam: MHC_II_alpha C1-set Ig_3 Marek_A Ig_2
Other DBs
NCBI-GeneID: 100352927
NCBI-ProteinID: XP_002714660
LinkDB
Position
12
AA seq 254 aa
MFQNKAGILMALTLAFLLNLQGAEAITAEHVSVFVIFAQTHEPSGECMFEFDEDEVFHVD
LDKKQAIWYLPEFDRMFSVEAQGGLANIAAAKSNLNACIQHSNHTQAPNEPPEVIVFPKE
PVELGQPNTLICHIDKFFPPVLNVTWLRNGQPVTEGVSETVFLASTEFRFRKFHYLAFVP
SAADVYDCRVEHWGLDAPLLTHWEAQEPIQMPETTETVVCALGLVVGLAGVVVGIVLITK
ALRSSPDPRARGPL
NT seq 765 nt   +upstreamnt  +downstreamnt
atgttccagaacaaagctggcatccttatggccctcaccctggctttcctgctcaatctc
caaggagctgaggccatcacagcagagcatgtgtcagtttttgtcatatttgcacagacg
cacgaaccatcaggggagtgtatgttcgaattcgatgaggatgaagtgttccatgtggat
ctggacaagaaacaggcgatctggtacctgccggagtttgatcgcatgttttccgtggag
gctcagggcggcctggccaatattgctgcagccaagtcaaacttgaatgcctgtatccag
cactccaaccacacccaggcccccaacgagcccccggaggtgatcgtgtttcccaaggag
ccagtggagctgggccagcccaacacactcatctgccacatcgacaagttcttcccgccg
gtgctcaatgtcacgtggctgcgtaacgggcagccggtcaccgagggggtctctgagacc
gtctttctggccagcaccgaattcagattccgcaagttccactacctggccttcgtgccc
tccgccgccgacgtctacgactgcagggtggagcactggggcctggacgcgccgctcctc
acgcactgggaggcccaggagccgatccagatgcccgagacaacagagactgtggtctgt
gccctgggcctggtggtgggcctggcgggcgtcgtggttggcatcgtcctcatcacaaag
gctctgcgttccagtcctgatccccgggcccgcgggcccctgtga

KEGG   Oryctolagus cuniculus (rabbit): 100355948
Entry
100355948         CDS       T03373                                 

Gene name
RLA-DMB
Definition
(RefSeq) histocompatibility antigen DM heterodimer light chain-like
  KO
K06752  MHC class II antigen
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04145  Phagosome
ocu04514  Cell adhesion molecules
ocu04612  Antigen processing and presentation
ocu04640  Hematopoietic cell lineage
ocu04658  Th1 and Th2 cell differentiation
ocu04659  Th17 cell differentiation
ocu04672  Intestinal immune network for IgA production
ocu04940  Type I diabetes mellitus
ocu05140  Leishmaniasis
ocu05145  Toxoplasmosis
ocu05150  Staphylococcus aureus infection
ocu05152  Tuberculosis
ocu05164  Influenza A
ocu05166  Human T-cell leukemia virus 1 infection
ocu05168  Herpes simplex virus 1 infection
ocu05169  Epstein-Barr virus infection
ocu05310  Asthma
ocu05320  Autoimmune thyroid disease
ocu05321  Inflammatory bowel disease
ocu05322  Systemic lupus erythematosus
ocu05323  Rheumatoid arthritis
ocu05330  Allograft rejection
ocu05332  Graft-versus-host disease
ocu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100355948 (RLA-DMB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100355948 (RLA-DMB)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100355948 (RLA-DMB)
   04612 Antigen processing and presentation
    100355948 (RLA-DMB)
   04658 Th1 and Th2 cell differentiation
    100355948 (RLA-DMB)
   04659 Th17 cell differentiation
    100355948 (RLA-DMB)
   04672 Intestinal immune network for IgA production
    100355948 (RLA-DMB)
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    100355948 (RLA-DMB)
   05322 Systemic lupus erythematosus
    100355948 (RLA-DMB)
   05323 Rheumatoid arthritis
    100355948 (RLA-DMB)
   05320 Autoimmune thyroid disease
    100355948 (RLA-DMB)
   05321 Inflammatory bowel disease
    100355948 (RLA-DMB)
   05330 Allograft rejection
    100355948 (RLA-DMB)
   05332 Graft-versus-host disease
    100355948 (RLA-DMB)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100355948 (RLA-DMB)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100355948 (RLA-DMB)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    100355948 (RLA-DMB)
   05152 Tuberculosis
    100355948 (RLA-DMB)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100355948 (RLA-DMB)
   05164 Influenza A
    100355948 (RLA-DMB)
   05168 Herpes simplex virus 1 infection
    100355948 (RLA-DMB)
   05169 Epstein-Barr virus infection
    100355948 (RLA-DMB)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100355948 (RLA-DMB)
   05140 Leishmaniasis
    100355948 (RLA-DMB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ocu04147]
    100355948 (RLA-DMB)
Exosome [BR:ocu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100355948 (RLA-DMB)
  Exosomal proteins of epithelial cells
   100355948 (RLA-DMB)
  Exosomal proteins of breast milk
   100355948 (RLA-DMB)
SSDB
Motif
Pfam: C1-set MHC_II_beta Ig_3 Ig_2 C2-set_2 I-set ig
Other DBs
NCBI-GeneID: 100355948
NCBI-ProteinID: NP_001177362
Ensembl: ENSOCUG00000026567
UniProt: O02873
LinkDB
Position
12
AA seq 257 aa
MSALLPLLLGFSLGCTGAGGFVAHVESTCLLDDDGTPRDFTYCISFNKDLLTCWDPQEGQ
LTPVEFGVLNPLAISISEYLNHSDTLLQRLHNGLKNCGTHTQPFWTSLTHRTRPPTVQVA
QTTPFNTREPVMLACYVWGFYPADVTITWMKNGQLVIPHSSMEKTAQPNGDWTYQTLSHL
ALTPSYGDTYTCVVEHIGAPEPILQNWTPGLSPTLTVKVSVSVVTLGVGSIIFSLGLICW
RKYGFSSYTPLPGSNYP
NT seq 774 nt   +upstreamnt  +downstreamnt
atgagcgcccttctgccgctgctgctgggcttcagcctgggctgcacgggagcaggtggc
tttgtggctcatgtggaaagtacttgtttgttggatgatgatgggactccaagggatttc
acatattgtatctccttcaacaaggatctgctaacctgctgggatccacaggagggccaa
ctaacccctgttgaatttggggtactgaatcccttggccataagcatctcagagtacctt
aaccacagtgataccctgctgcagcgcctgcacaatggactcaagaactgtggcacacac
actcagcctttctggacatcactgacccacagaacacgaccaccaactgtacaagtagcc
caaaccactccttttaacacaagggagcccgtgatgctggcttgctatgtgtggggcttc
tacccagcagatgtgaccatcacatggatgaagaacgggcaacttgtcatccctcatagc
agtatggagaagactgcgcagcccaatggagactggacataccagaccctctctcattta
gccctcactccctcttacggggatacatacacctgtgtggtggagcacattggggcacct
gagcccatcctacagaactggacacctgggctgtcccccacgttgacggtgaaggtttct
gtgtcggtagtgactctgggtgtgggctccattatcttctcccttggtttgatctgctgg
cggaagtacggcttctctagctacactcccctccctgggtccaattatccgtaa

DBGET integrated database retrieval system