KEGG   Oryctolagus cuniculus (rabbit): 100337822
Entry
100337822         CDS       T03373                                 

Gene name
PIK3CA
Definition
(RefSeq) phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu00562  Inositol phosphate metabolism
ocu01100  Metabolic pathways
ocu01521  EGFR tyrosine kinase inhibitor resistance
ocu01522  Endocrine resistance
ocu01524  Platinum drug resistance
ocu04012  ErbB signaling pathway
ocu04014  Ras signaling pathway
ocu04015  Rap1 signaling pathway
ocu04024  cAMP signaling pathway
ocu04062  Chemokine signaling pathway
ocu04066  HIF-1 signaling pathway
ocu04068  FoxO signaling pathway
ocu04070  Phosphatidylinositol signaling system
ocu04071  Sphingolipid signaling pathway
ocu04072  Phospholipase D signaling pathway
ocu04140  Autophagy - animal
ocu04150  mTOR signaling pathway
ocu04151  PI3K-Akt signaling pathway
ocu04152  AMPK signaling pathway
ocu04210  Apoptosis
ocu04211  Longevity regulating pathway
ocu04213  Longevity regulating pathway - multiple species
ocu04218  Cellular senescence
ocu04360  Axon guidance
ocu04370  VEGF signaling pathway
ocu04380  Osteoclast differentiation
ocu04510  Focal adhesion
ocu04550  Signaling pathways regulating pluripotency of stem cells
ocu04611  Platelet activation
ocu04620  Toll-like receptor signaling pathway
ocu04625  C-type lectin receptor signaling pathway
ocu04630  JAK-STAT signaling pathway
ocu04650  Natural killer cell mediated cytotoxicity
ocu04660  T cell receptor signaling pathway
ocu04662  B cell receptor signaling pathway
ocu04664  Fc epsilon RI signaling pathway
ocu04666  Fc gamma R-mediated phagocytosis
ocu04668  TNF signaling pathway
ocu04670  Leukocyte transendothelial migration
ocu04722  Neurotrophin signaling pathway
ocu04725  Cholinergic synapse
ocu04750  Inflammatory mediator regulation of TRP channels
ocu04810  Regulation of actin cytoskeleton
ocu04910  Insulin signaling pathway
ocu04914  Progesterone-mediated oocyte maturation
ocu04915  Estrogen signaling pathway
ocu04917  Prolactin signaling pathway
ocu04919  Thyroid hormone signaling pathway
ocu04923  Regulation of lipolysis in adipocytes
ocu04926  Relaxin signaling pathway
ocu04929  GnRH secretion
ocu04930  Type II diabetes mellitus
ocu04931  Insulin resistance
ocu04932  Non-alcoholic fatty liver disease
ocu04933  AGE-RAGE signaling pathway in diabetic complications
ocu04935  Growth hormone synthesis, secretion and action
ocu04960  Aldosterone-regulated sodium reabsorption
ocu04973  Carbohydrate digestion and absorption
ocu05010  Alzheimer disease
ocu05017  Spinocerebellar ataxia
ocu05020  Prion disease
ocu05100  Bacterial invasion of epithelial cells
ocu05132  Salmonella infection
ocu05135  Yersinia infection
ocu05142  Chagas disease
ocu05146  Amoebiasis
ocu05160  Hepatitis C
ocu05161  Hepatitis B
ocu05162  Measles
ocu05163  Human cytomegalovirus infection
ocu05164  Influenza A
ocu05165  Human papillomavirus infection
ocu05166  Human T-cell leukemia virus 1 infection
ocu05167  Kaposi sarcoma-associated herpesvirus infection
ocu05168  Herpes simplex virus 1 infection
ocu05169  Epstein-Barr virus infection
ocu05170  Human immunodeficiency virus 1 infection
ocu05200  Pathways in cancer
ocu05203  Viral carcinogenesis
ocu05205  Proteoglycans in cancer
ocu05206  MicroRNAs in cancer
ocu05210  Colorectal cancer
ocu05211  Renal cell carcinoma
ocu05212  Pancreatic cancer
ocu05213  Endometrial cancer
ocu05214  Glioma
ocu05215  Prostate cancer
ocu05218  Melanoma
ocu05220  Chronic myeloid leukemia
ocu05221  Acute myeloid leukemia
ocu05222  Small cell lung cancer
ocu05223  Non-small cell lung cancer
ocu05224  Breast cancer
ocu05225  Hepatocellular carcinoma
ocu05226  Gastric cancer
ocu05230  Central carbon metabolism in cancer
ocu05231  Choline metabolism in cancer
ocu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ocu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100337822 (PIK3CA)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100337822 (PIK3CA)
   04014 Ras signaling pathway
    100337822 (PIK3CA)
   04015 Rap1 signaling pathway
    100337822 (PIK3CA)
   04370 VEGF signaling pathway
    100337822 (PIK3CA)
   04630 JAK-STAT signaling pathway
    100337822 (PIK3CA)
   04668 TNF signaling pathway
    100337822 (PIK3CA)
   04066 HIF-1 signaling pathway
    100337822 (PIK3CA)
   04068 FoxO signaling pathway
    100337822 (PIK3CA)
   04070 Phosphatidylinositol signaling system
    100337822 (PIK3CA)
   04072 Phospholipase D signaling pathway
    100337822 (PIK3CA)
   04071 Sphingolipid signaling pathway
    100337822 (PIK3CA)
   04024 cAMP signaling pathway
    100337822 (PIK3CA)
   04151 PI3K-Akt signaling pathway
    100337822 (PIK3CA)
   04152 AMPK signaling pathway
    100337822 (PIK3CA)
   04150 mTOR signaling pathway
    100337822 (PIK3CA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100337822 (PIK3CA)
  09143 Cell growth and death
   04210 Apoptosis
    100337822 (PIK3CA)
   04218 Cellular senescence
    100337822 (PIK3CA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100337822 (PIK3CA)
   04550 Signaling pathways regulating pluripotency of stem cells
    100337822 (PIK3CA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100337822 (PIK3CA)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100337822 (PIK3CA)
   04620 Toll-like receptor signaling pathway
    100337822 (PIK3CA)
   04625 C-type lectin receptor signaling pathway
    100337822 (PIK3CA)
   04650 Natural killer cell mediated cytotoxicity
    100337822 (PIK3CA)
   04660 T cell receptor signaling pathway
    100337822 (PIK3CA)
   04662 B cell receptor signaling pathway
    100337822 (PIK3CA)
   04664 Fc epsilon RI signaling pathway
    100337822 (PIK3CA)
   04666 Fc gamma R-mediated phagocytosis
    100337822 (PIK3CA)
   04670 Leukocyte transendothelial migration
    100337822 (PIK3CA)
   04062 Chemokine signaling pathway
    100337822 (PIK3CA)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100337822 (PIK3CA)
   04923 Regulation of lipolysis in adipocytes
    100337822 (PIK3CA)
   04929 GnRH secretion
    100337822 (PIK3CA)
   04915 Estrogen signaling pathway
    100337822 (PIK3CA)
   04914 Progesterone-mediated oocyte maturation
    100337822 (PIK3CA)
   04917 Prolactin signaling pathway
    100337822 (PIK3CA)
   04926 Relaxin signaling pathway
    100337822 (PIK3CA)
   04935 Growth hormone synthesis, secretion and action
    100337822 (PIK3CA)
   04919 Thyroid hormone signaling pathway
    100337822 (PIK3CA)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    100337822 (PIK3CA)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100337822 (PIK3CA)
  09156 Nervous system
   04725 Cholinergic synapse
    100337822 (PIK3CA)
   04722 Neurotrophin signaling pathway
    100337822 (PIK3CA)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100337822 (PIK3CA)
  09158 Development and regeneration
   04360 Axon guidance
    100337822 (PIK3CA)
   04380 Osteoclast differentiation
    100337822 (PIK3CA)
  09149 Aging
   04211 Longevity regulating pathway
    100337822 (PIK3CA)
   04213 Longevity regulating pathway - multiple species
    100337822 (PIK3CA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100337822 (PIK3CA)
   05206 MicroRNAs in cancer
    100337822 (PIK3CA)
   05205 Proteoglycans in cancer
    100337822 (PIK3CA)
   05203 Viral carcinogenesis
    100337822 (PIK3CA)
   05230 Central carbon metabolism in cancer
    100337822 (PIK3CA)
   05231 Choline metabolism in cancer
    100337822 (PIK3CA)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100337822 (PIK3CA)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100337822 (PIK3CA)
   05212 Pancreatic cancer
    100337822 (PIK3CA)
   05225 Hepatocellular carcinoma
    100337822 (PIK3CA)
   05226 Gastric cancer
    100337822 (PIK3CA)
   05214 Glioma
    100337822 (PIK3CA)
   05221 Acute myeloid leukemia
    100337822 (PIK3CA)
   05220 Chronic myeloid leukemia
    100337822 (PIK3CA)
   05218 Melanoma
    100337822 (PIK3CA)
   05211 Renal cell carcinoma
    100337822 (PIK3CA)
   05215 Prostate cancer
    100337822 (PIK3CA)
   05213 Endometrial cancer
    100337822 (PIK3CA)
   05224 Breast cancer
    100337822 (PIK3CA)
   05222 Small cell lung cancer
    100337822 (PIK3CA)
   05223 Non-small cell lung cancer
    100337822 (PIK3CA)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100337822 (PIK3CA)
   05017 Spinocerebellar ataxia
    100337822 (PIK3CA)
   05020 Prion disease
    100337822 (PIK3CA)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100337822 (PIK3CA)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100337822 (PIK3CA)
   04932 Non-alcoholic fatty liver disease
    100337822 (PIK3CA)
   04931 Insulin resistance
    100337822 (PIK3CA)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100337822 (PIK3CA)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100337822 (PIK3CA)
   05135 Yersinia infection
    100337822 (PIK3CA)
   05100 Bacterial invasion of epithelial cells
    100337822 (PIK3CA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100337822 (PIK3CA)
   05170 Human immunodeficiency virus 1 infection
    100337822 (PIK3CA)
   05162 Measles
    100337822 (PIK3CA)
   05164 Influenza A
    100337822 (PIK3CA)
   05161 Hepatitis B
    100337822 (PIK3CA)
   05160 Hepatitis C
    100337822 (PIK3CA)
   05168 Herpes simplex virus 1 infection
    100337822 (PIK3CA)
   05163 Human cytomegalovirus infection
    100337822 (PIK3CA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100337822 (PIK3CA)
   05169 Epstein-Barr virus infection
    100337822 (PIK3CA)
   05165 Human papillomavirus infection
    100337822 (PIK3CA)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100337822 (PIK3CA)
   05142 Chagas disease
    100337822 (PIK3CA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100337822 (PIK3CA)
   01524 Platinum drug resistance
    100337822 (PIK3CA)
   01522 Endocrine resistance
    100337822 (PIK3CA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100337822 (PIK3CA)
Enzymes [BR:ocu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     100337822 (PIK3CA)
Membrane trafficking [BR:ocu04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    100337822 (PIK3CA)
SSDB
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_rbd PI3K_C2 PI3K_p85B DUF2321 ASC
Other DBs
NCBI-GeneID: 100337822
NCBI-ProteinID: XP_008264758
Ensembl: ENSOCUG00000010631
UniProt: U3KM40
LinkDB
Position
14
AA seq 1068 aa
MPPRPSSGELWGIHLMPPRILVECLLPNGMIVTLECLREATLITIKHELFKEARKYPLHQ
LLQDESSYIFVSVTQEAEREEFFDETRRLCDLRLFQPFLKVIEPVGNREEKILNREIGFV
IGMPVCEFDMVKDPEVQDFRRNILNVCKEAVDLRDLNSPHSRAMYVYPPNVESSPELPKH
IYNKLDKGQIIVVIWVIVSPNNDKQKYTLKINHDCVPEQVIAEAIRKKTRSMLLSSEQLK
LCVLEYQGKYILKVCGCDEYFLEKYPLSQYKYIRSCIMLGRMPNLMLMAKESLYSQLPMD
CFTMPSYSRRISTATPYMNGETSTKSLWVINSALRIKILCATYVNVNIRDIDKIYVRTGI
YHGGEPLCDNVNTQRVPCSNPRWNEWLNYDIYIPDLPRAARLCLSICSVKGRKGAKEEHC
PLAWGNINLFDYTDTLVSGKMALNLWPVPHGLEDLLNPIGVTGSNPNKETPCLELEFDWF
SSVVKFPDMSVIEEHANWSVSREAGFSYSHAGLSNRLARDNELRENDKEQLRAICTRDPL
SEITEQEKDFLWSHRHYCVTIPEILPKLLLSVKWNSRDEVAQMYCLVKDWPPIKPEQAME
LLDCNYPDPMVRAFAVRCLEKYLTDDKLSQYLIQLVQVLKYEQYLDNLLVRFLLKKALTN
QRIGHFFFWHLKSEMHNKTVSQRFGLLLESYCRACGMYLKHLNRQVEAMEKLINLTDILK
QEKKDETQKVQMKFLVEQMRQPDFMDALQGFLSPLNPAHQLGNLRLEECRIMSSAKRPLW
LNWENPDIMSELLFQNNEIIFKNGDDLRQDMLTLQIIRIMENIWQNQGLDLRMLPYGCLS
IGDCVGLIEVVRNSHTIMQIQCKGGLKGALQFNSHTLHQWLKDKNKGEIYDAAIDLFTRS
CAGYCVATFILGIGDRHNSNIMVKDDGQLFHIDFGHFLDHKKKKFGYKRERVPFVLTQDF
LIVISKGAQECTKTREFERFQEMCYKAYLAIRQHANLFINLFSMMLGSGMPELQSFDDIA
YIRKTLALDKTEQEALEYFMKQMNDAHHGGWTTKMDWIFHTIKQHALN
NT seq 3207 nt   +upstreamnt  +downstreamnt
atgcctccacgaccatcatcaggtgaactgtggggcatccacttgatgcccccaagaatc
ttagtagaatgtttactgccaaatggaatgatagtgactttagaatgcctccgtgaggct
acattaattactataaagcatgaactatttaaagaagcaagaaaataccctctccatcaa
cttcttcaagatgaatcttcttacattttcgtaagtgttacccaagaagcagaaagggaa
gaattttttgatgaaacaaggcgcctttgtgaccttcggctttttcaaccctttttaaaa
gtaattgaaccagtaggcaaccgtgaagaaaagatcctgaatcgagaaattggttttgtt
attggcatgccagtgtgtgaatttgatatggttaaagatccagaagtacaggacttccga
agaaatattctgaatgtttgtaaagaagctgtggatcttagagatctgaattcacctcat
agtagagcaatgtatgtctatcctccaaatgtagaatcttcaccagaactgccaaagcac
atatataataaattagataaagggcaaataatagtggtgatttgggtaatagtttctcca
aataatgataagcagaagtataccctgaaaatcaaccatgactgtgtgccagaacaagta
attgctgaagcaatcaggaagaaaacccggagcatgttgctatcctctgaacaactaaaa
ctatgtgttttagaatatcagggcaagtatattttaaaagtgtgtggatgtgatgaatac
ttcttagaaaaatatcctctgagtcagtataagtatataagaagctgtataatgcttggg
aggatgcccaatttgatgctgatggctaaagaaagcctttattctcaactgccaatggac
tgttttacaatgccatcttattccagacgcatctccactgctacaccatatatgaatgga
gaaacatctacaaaatccctttgggttataaatagtgcactcagaataaaaattctttgt
gctacctatgtgaatgtaaatattcgagacattgacaagatctatgttcgaacaggtatc
taccatggaggagaacctttatgtgacaatgtgaacactcaaagagtaccttgttccaat
cccaggtggaatgaatggctgaattatgatatatacattcctgatcttcctcgtgctgct
cgactttgcctttctatatgctctgttaaaggccgaaagggtgctaaggaggaacactgt
ccactggcttggggaaatataaacttgtttgattacactgacactctggtatctggaaaa
atggctctgaatctttggccagtacctcatggattagaagatttactgaaccctattggt
gttactgggtcaaatccaaataaagaaactccatgcttagagttggagtttgactggttt
agcagtgtggtaaagtttccagatatgtcagtgattgaggaacatgccaattggtctgta
tccagagaagcaggatttagttattcccatgcaggactgagtaacagactagcaagagac
aatgaattaagagaaaatgataaagaacagctccgagcaatctgtacacgcgatcctcta
tctgaaatcactgagcaagagaaagattttctgtggagccacagacattattgtgtaact
atcccagagattctacccaaattgcttctgtctgttaaatggaattctagagatgaagtt
gcccagatgtactgcttggtaaaagattggcctccaataaaacctgagcaggccatggag
ctcctggactgcaactacccagatccgatggttcgagcttttgctgttcgatgcttggaa
aaatatttaacagatgacaaactttctcagtatctgattcagctagtacaggtcctaaaa
tatgaacagtatttggataaccttctcgtgagatttttactcaagaaagcattgactaac
caaaggattgggcactttttcttttggcatttaaaatctgagatgcacaataaaacagtt
agtcagaggtttggcctgcttttggagtcctactgccgggcatgtggaatgtatttgaag
cacctgaataggcaagttgaggctatggaaaagctcattaacttgactgacattctcaaa
caggagaagaaggatgaaacacaaaaggtacaaatgaagtttttagttgagcaaatgagg
caaccagatttcatggatgctctacagggctttctgtctcctttaaaccctgctcatcaa
ctgggaaatctcaggcttgaagagtgtcgaataatgtcctctgcaaaaaggccactgtgg
ttgaattgggagaacccagacatcatgtcagagttactgtttcagaacaatgagatcatc
tttaaaaatggggatgatttacggcaagatatgctaacacttcaaattattcgcattatg
gaaaatatctggcaaaatcaaggtcttgatcttcgaatgttaccttatggttgtctgtca
attggtgactgtgtgggacttattgaggtggtgagaaattctcacactatcatgcagatt
cagtgcaaaggtggcctgaaaggtgcactgcagttcaatagccatacactgcatcagtgg
ctcaaagacaagaacaaaggagaaatatatgatgcagccattgacctgttcacccgttca
tgtgctggctattgcgttgcaactttcatcttgggaattggagatcggcacaacagtaac
atcatggtgaaagatgatggacaactgtttcatatagatttcggacactttttggaccac
aagaagaaaaaatttggttataagcgagaacgtgtaccatttgttctgacacaggatttc
ttaatagtgattagtaaaggagcccaagaatgcacaaaaactagagaatttgagaggttt
caagagatgtgttacaaggcttatctagctattcggcagcatgccaatctcttcataaat
cttttctcaatgatgcttggctctggaatgccagaactgcaatcttttgatgacattgca
tatattcgaaagaccctagccttagataaaactgagcaggaggctttggaatatttcatg
aaacaaatgaacgatgcacatcatggtggctggacaacaaaaatggattggatcttccac
acaattaagcagcatgcattgaactga

KEGG   Oryctolagus cuniculus (rabbit): 100345181
Entry
100345181         CDS       T03373                                 

Gene name
PIK3CB
Definition
(RefSeq) phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit beta
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu00562  Inositol phosphate metabolism
ocu01100  Metabolic pathways
ocu01521  EGFR tyrosine kinase inhibitor resistance
ocu01522  Endocrine resistance
ocu01524  Platinum drug resistance
ocu04012  ErbB signaling pathway
ocu04014  Ras signaling pathway
ocu04015  Rap1 signaling pathway
ocu04024  cAMP signaling pathway
ocu04062  Chemokine signaling pathway
ocu04066  HIF-1 signaling pathway
ocu04068  FoxO signaling pathway
ocu04070  Phosphatidylinositol signaling system
ocu04071  Sphingolipid signaling pathway
ocu04072  Phospholipase D signaling pathway
ocu04140  Autophagy - animal
ocu04150  mTOR signaling pathway
ocu04151  PI3K-Akt signaling pathway
ocu04152  AMPK signaling pathway
ocu04210  Apoptosis
ocu04211  Longevity regulating pathway
ocu04213  Longevity regulating pathway - multiple species
ocu04218  Cellular senescence
ocu04360  Axon guidance
ocu04370  VEGF signaling pathway
ocu04380  Osteoclast differentiation
ocu04510  Focal adhesion
ocu04550  Signaling pathways regulating pluripotency of stem cells
ocu04611  Platelet activation
ocu04620  Toll-like receptor signaling pathway
ocu04625  C-type lectin receptor signaling pathway
ocu04630  JAK-STAT signaling pathway
ocu04650  Natural killer cell mediated cytotoxicity
ocu04660  T cell receptor signaling pathway
ocu04662  B cell receptor signaling pathway
ocu04664  Fc epsilon RI signaling pathway
ocu04666  Fc gamma R-mediated phagocytosis
ocu04668  TNF signaling pathway
ocu04670  Leukocyte transendothelial migration
ocu04722  Neurotrophin signaling pathway
ocu04725  Cholinergic synapse
ocu04750  Inflammatory mediator regulation of TRP channels
ocu04810  Regulation of actin cytoskeleton
ocu04910  Insulin signaling pathway
ocu04914  Progesterone-mediated oocyte maturation
ocu04915  Estrogen signaling pathway
ocu04917  Prolactin signaling pathway
ocu04919  Thyroid hormone signaling pathway
ocu04923  Regulation of lipolysis in adipocytes
ocu04926  Relaxin signaling pathway
ocu04929  GnRH secretion
ocu04930  Type II diabetes mellitus
ocu04931  Insulin resistance
ocu04932  Non-alcoholic fatty liver disease
ocu04933  AGE-RAGE signaling pathway in diabetic complications
ocu04935  Growth hormone synthesis, secretion and action
ocu04960  Aldosterone-regulated sodium reabsorption
ocu04973  Carbohydrate digestion and absorption
ocu05010  Alzheimer disease
ocu05017  Spinocerebellar ataxia
ocu05020  Prion disease
ocu05100  Bacterial invasion of epithelial cells
ocu05132  Salmonella infection
ocu05135  Yersinia infection
ocu05142  Chagas disease
ocu05146  Amoebiasis
ocu05160  Hepatitis C
ocu05161  Hepatitis B
ocu05162  Measles
ocu05163  Human cytomegalovirus infection
ocu05164  Influenza A
ocu05165  Human papillomavirus infection
ocu05166  Human T-cell leukemia virus 1 infection
ocu05167  Kaposi sarcoma-associated herpesvirus infection
ocu05168  Herpes simplex virus 1 infection
ocu05169  Epstein-Barr virus infection
ocu05170  Human immunodeficiency virus 1 infection
ocu05200  Pathways in cancer
ocu05203  Viral carcinogenesis
ocu05205  Proteoglycans in cancer
ocu05206  MicroRNAs in cancer
ocu05210  Colorectal cancer
ocu05211  Renal cell carcinoma
ocu05212  Pancreatic cancer
ocu05213  Endometrial cancer
ocu05214  Glioma
ocu05215  Prostate cancer
ocu05218  Melanoma
ocu05220  Chronic myeloid leukemia
ocu05221  Acute myeloid leukemia
ocu05222  Small cell lung cancer
ocu05223  Non-small cell lung cancer
ocu05224  Breast cancer
ocu05225  Hepatocellular carcinoma
ocu05226  Gastric cancer
ocu05230  Central carbon metabolism in cancer
ocu05231  Choline metabolism in cancer
ocu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ocu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100345181 (PIK3CB)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100345181 (PIK3CB)
   04014 Ras signaling pathway
    100345181 (PIK3CB)
   04015 Rap1 signaling pathway
    100345181 (PIK3CB)
   04370 VEGF signaling pathway
    100345181 (PIK3CB)
   04630 JAK-STAT signaling pathway
    100345181 (PIK3CB)
   04668 TNF signaling pathway
    100345181 (PIK3CB)
   04066 HIF-1 signaling pathway
    100345181 (PIK3CB)
   04068 FoxO signaling pathway
    100345181 (PIK3CB)
   04070 Phosphatidylinositol signaling system
    100345181 (PIK3CB)
   04072 Phospholipase D signaling pathway
    100345181 (PIK3CB)
   04071 Sphingolipid signaling pathway
    100345181 (PIK3CB)
   04024 cAMP signaling pathway
    100345181 (PIK3CB)
   04151 PI3K-Akt signaling pathway
    100345181 (PIK3CB)
   04152 AMPK signaling pathway
    100345181 (PIK3CB)
   04150 mTOR signaling pathway
    100345181 (PIK3CB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100345181 (PIK3CB)
  09143 Cell growth and death
   04210 Apoptosis
    100345181 (PIK3CB)
   04218 Cellular senescence
    100345181 (PIK3CB)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100345181 (PIK3CB)
   04550 Signaling pathways regulating pluripotency of stem cells
    100345181 (PIK3CB)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100345181 (PIK3CB)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100345181 (PIK3CB)
   04620 Toll-like receptor signaling pathway
    100345181 (PIK3CB)
   04625 C-type lectin receptor signaling pathway
    100345181 (PIK3CB)
   04650 Natural killer cell mediated cytotoxicity
    100345181 (PIK3CB)
   04660 T cell receptor signaling pathway
    100345181 (PIK3CB)
   04662 B cell receptor signaling pathway
    100345181 (PIK3CB)
   04664 Fc epsilon RI signaling pathway
    100345181 (PIK3CB)
   04666 Fc gamma R-mediated phagocytosis
    100345181 (PIK3CB)
   04670 Leukocyte transendothelial migration
    100345181 (PIK3CB)
   04062 Chemokine signaling pathway
    100345181 (PIK3CB)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100345181 (PIK3CB)
   04923 Regulation of lipolysis in adipocytes
    100345181 (PIK3CB)
   04929 GnRH secretion
    100345181 (PIK3CB)
   04915 Estrogen signaling pathway
    100345181 (PIK3CB)
   04914 Progesterone-mediated oocyte maturation
    100345181 (PIK3CB)
   04917 Prolactin signaling pathway
    100345181 (PIK3CB)
   04926 Relaxin signaling pathway
    100345181 (PIK3CB)
   04935 Growth hormone synthesis, secretion and action
    100345181 (PIK3CB)
   04919 Thyroid hormone signaling pathway
    100345181 (PIK3CB)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    100345181 (PIK3CB)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100345181 (PIK3CB)
  09156 Nervous system
   04725 Cholinergic synapse
    100345181 (PIK3CB)
   04722 Neurotrophin signaling pathway
    100345181 (PIK3CB)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100345181 (PIK3CB)
  09158 Development and regeneration
   04360 Axon guidance
    100345181 (PIK3CB)
   04380 Osteoclast differentiation
    100345181 (PIK3CB)
  09149 Aging
   04211 Longevity regulating pathway
    100345181 (PIK3CB)
   04213 Longevity regulating pathway - multiple species
    100345181 (PIK3CB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100345181 (PIK3CB)
   05206 MicroRNAs in cancer
    100345181 (PIK3CB)
   05205 Proteoglycans in cancer
    100345181 (PIK3CB)
   05203 Viral carcinogenesis
    100345181 (PIK3CB)
   05230 Central carbon metabolism in cancer
    100345181 (PIK3CB)
   05231 Choline metabolism in cancer
    100345181 (PIK3CB)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100345181 (PIK3CB)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100345181 (PIK3CB)
   05212 Pancreatic cancer
    100345181 (PIK3CB)
   05225 Hepatocellular carcinoma
    100345181 (PIK3CB)
   05226 Gastric cancer
    100345181 (PIK3CB)
   05214 Glioma
    100345181 (PIK3CB)
   05221 Acute myeloid leukemia
    100345181 (PIK3CB)
   05220 Chronic myeloid leukemia
    100345181 (PIK3CB)
   05218 Melanoma
    100345181 (PIK3CB)
   05211 Renal cell carcinoma
    100345181 (PIK3CB)
   05215 Prostate cancer
    100345181 (PIK3CB)
   05213 Endometrial cancer
    100345181 (PIK3CB)
   05224 Breast cancer
    100345181 (PIK3CB)
   05222 Small cell lung cancer
    100345181 (PIK3CB)
   05223 Non-small cell lung cancer
    100345181 (PIK3CB)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100345181 (PIK3CB)
   05017 Spinocerebellar ataxia
    100345181 (PIK3CB)
   05020 Prion disease
    100345181 (PIK3CB)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100345181 (PIK3CB)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100345181 (PIK3CB)
   04932 Non-alcoholic fatty liver disease
    100345181 (PIK3CB)
   04931 Insulin resistance
    100345181 (PIK3CB)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100345181 (PIK3CB)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100345181 (PIK3CB)
   05135 Yersinia infection
    100345181 (PIK3CB)
   05100 Bacterial invasion of epithelial cells
    100345181 (PIK3CB)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100345181 (PIK3CB)
   05170 Human immunodeficiency virus 1 infection
    100345181 (PIK3CB)
   05162 Measles
    100345181 (PIK3CB)
   05164 Influenza A
    100345181 (PIK3CB)
   05161 Hepatitis B
    100345181 (PIK3CB)
   05160 Hepatitis C
    100345181 (PIK3CB)
   05168 Herpes simplex virus 1 infection
    100345181 (PIK3CB)
   05163 Human cytomegalovirus infection
    100345181 (PIK3CB)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100345181 (PIK3CB)
   05169 Epstein-Barr virus infection
    100345181 (PIK3CB)
   05165 Human papillomavirus infection
    100345181 (PIK3CB)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100345181 (PIK3CB)
   05142 Chagas disease
    100345181 (PIK3CB)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100345181 (PIK3CB)
   01524 Platinum drug resistance
    100345181 (PIK3CB)
   01522 Endocrine resistance
    100345181 (PIK3CB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100345181 (PIK3CB)
Enzymes [BR:ocu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     100345181 (PIK3CB)
Membrane trafficking [BR:ocu04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    100345181 (PIK3CB)
SSDB
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_rbd PI3K_p85B PI3K_C2 Tom37_C DUF4381
Other DBs
NCBI-GeneID: 100345181
NCBI-ProteinID: XP_002716594
Ensembl: ENSOCUG00000004899
UniProt: G1SMR9
LinkDB
Position
14
AA seq 1070 aa
MCFSFIMPPAMADILDIWAVDSQIASDGSIPVDFLLPTGIYIQLEVPREATISYIKQLLW
KQVHNYPMFNLLMEIDAYMFACVNQTAVYEELEDETRRLCDVRPFLPVLKLVTRSCDPGE
KLDSKIGVLIGKGLHEFDALKDPEVNEFRRKMRKFSEEKIQSLVGLSWIDWLKQTYPPEH
DPSSLENLEDKLYGGKLIVAVHFENSQDVFSFQVSPNMNPIKINELAIQKRLTIHGKEDE
ASPYDYVLQVSGRVEYVFGDHPLIQFQYIRNCVMNRTLPHFILVECCKIKKMYEQEMIAI
EAAINRNSSNLPLPLPPKKTRITSHVWENNNPFQIVLVKGNKLNTEETVKVHVRAGLFHG
TELLCKTIVSSEISGKNDHIWNEPLEFDINTCDLPRMARLCFAVYAVLDKVKTKKSTKTI
NPSKYQTIRKAGKVHYPVAWVNTMVFDFKGQLRSGDVILHSWSSFPDELEEMLNPMGTVQ
TNPYTENATALHIKFPENKKQPYYYPPFDKIIEKAAEIASNDSANVSSRGGKKFLAVLKE
ILDRDPLSQLCENEMDLIWTLRQDCRENFPQSLPKLLLSIKWNKLEDVAQLQALLQIWPK
LPPREALELLDFNYPDQYVREYAVGCLRQMSDEELSQYLLQLVQVLKYEPFLDCALSRFL
LERALANRRIGQFLFWHLRSEVHIPAVSVQFGVILEAYCRGSVGHMKVLSKQVEALNKLK
TLNSLIKLNAVKLNRAKGKEAMHTCLKQNAYREALSDLQSPLNPCVILSELYVEKCKYMD
SKMKPLWLVYNNKVFGEDSVGVIFKNGDDLRQDMLTLQMLRLMDLLWKEAGLDLRMLPYG
CLATGDRSGLIEVVSTSETIADIQLNSSNVAAAAAFNKDALLNWLKEYNSGDDLDRAIEE
FTLSCAGYCVASYVLGIGDRHSDNIMVKKTGQLFHIDFGHILGNFKSKFGIKRERVPFIL
TYDFIHVIQQGKTGNTEKFGRFRQCCEDAYLILRRHGNLFITLFALMLTAGLPELTSVKD
IQYLKDSLALGKSEEEALKQFKQKFDEALRESWTTKVNWMAHTVRKDYRS
NT seq 3213 nt   +upstreamnt  +downstreamnt
atgtgcttcagtttcataatgcctcctgctatggcagacatccttgacatctgggcagtg
gattcacagatagcatctgatggctccatacctgtggatttccttttgcccactgggatt
tatatccagttggaggtacctcgggaagccaccatttcttatattaagcagttgttatgg
aagcaagttcacaattacccaatgtttaaccttctgatggaaattgacgcctatatgttt
gcatgtgtgaatcaaactgctgtatatgaagaactcgaagatgaaacacgaagactttgt
gatgttagaccttttcttccagttctcaaattagtgacaagaagttgtgacccaggggaa
aaattagactcaaaaatcggagtccttataggaaaaggtttgcatgaatttgatgccttg
aaggatcctgaagtcaatgaatttcgaagaaaaatgcgcaaattcagtgaggaaaagatt
cagtcacttgtgggattgtcttggatagactggctaaagcagacatacccaccggagcat
gacccatccagccttgaaaacttagaagataaactctatggaggaaagctcattgtggct
gttcattttgaaaactctcaggatgtgtttagttttcaagtgtctcctaatatgaatcct
atcaaaataaatgagttggcaatccaaaaacgtttgactattcatgggaaggaagatgag
gctagcccctatgactacgtgttgcaagtcagtggacgagtggagtatgtatttggtgat
cacccactaattcagttccagtatatccggaattgtgtaatgaacagaactttgccccat
tttatacttgtggaatgctgcaagatcaagaaaatgtatgaacaggagatgattgccata
gaagctgccataaatcgaaattcatctaatcttcctcttcctttaccaccaaagaaaaca
cgaattacttctcatgtttgggagaataataatccattccaaattgtcttagttaaagga
aataagcttaacacagaagaaactgtaaaagttcatgtcagagctggtctttttcacggt
accgagctcctgtgtaaaaccatcgtaagctcagagatatcggggaaaaatgatcacatt
tggaatgaaccattggaatttgatattaatacttgtgacttgccaagaatggctcgattg
tgttttgctgtttatgcagttttagataaagtgaaaacaaagaagtcaactaaaactatt
aatccctctaaatatcagaccatcaggaaagctggaaaagtgcattatcctgtagcctgg
gtaaatacgatggtttttgactttaaaggacagttgagatctggagacgtaatattgcac
agctggtcttcatttcctgatgaactagaagaaatgttgaatccaatgggaaccgttcag
acaaatccatacactgaaaatgcaacagctttgcatattaaatttccagaaaataagaaa
caaccttattattaccctccctttgataagattattgaaaaggcagctgagattgcaagc
aacgatagtgctaatgtatcaagtcgaggtgggaaaaagtttcttgcagtactgaaagaa
atcttggacagagatccattgtcccaactgtgtgagaatgaaatggatcttatttggact
ttgcgacaagactgcagagagaacttcccacagtcactgccaaaattactcctatcaata
aagtggaataaacttgaggatgttgctcagcttcaagcactgcttcagatttggcctaaa
ttgcctcctcgggaggctttggagcttctggatttcaactacccagaccagtatgtgcgg
gaatatgctgtgggctgccttcggcagatgagtgatgaagaactctcgcagtacctttta
caactggtgcaagttttgaaatatgagccatttcttgattgtgccctgtctagattccta
ttagaaagagcgcttgctaatcggcggatagggcagtttctattttggcatcttaggtca
gaagtgcacattcctgctgtctcagtacagtttggcgtcatccttgaagcatactgcagg
ggaagtgtagggcacatgaaagtgctttccaaacaggttgaagcactcaataagttaaaa
accttaaatagtttaataaaactgaatgcagtgaagctaaacagagccaaagggaaggag
gccatgcacacctgtttaaaacagaatgcttaccgagaagccctctctgacctgcagtca
cccctgaacccatgtgtcatcctctcagaactctatgttgaaaagtgcaaatacatggat
tctaaaatgaaacctttgtggctggtatacaacaacaaggtatttggtgaggattcggtt
ggagtgatttttaaaaacggtgatgatttacgacaggatatgttgacacttcagatgctg
cgcttgatggatttactctggaaagaagctggtctggatcttcggatgctgccttatggc
tgtttagcaacaggagatcgctctggcctcattgaagttgtgagcacctctgaaacaatc
gctgacattcagctgaacagtagcaatgtggctgctgcagcagccttcaacaaagacgcc
cttctgaactggcttaaagagtacaattctggggatgacctggaccgagccattgaggag
tttaccctgtcctgtgctggctactgtgtagcctcttacgtcctcgggattggtgacaga
cacagtgacaacatcatggtcaaaaaaactggccagctcttccacattgactttggacat
attcttggaaatttcaaatctaagtttggcattaaaagggagcgagtgccttttatactt
acttatgattttattcatgttattcaacaaggaaaaacaggaaacacagaaaagtttggc
cggttccgccagtgctgtgaggacgcatatctcatcttacgacggcatgggaatctcttc
atcacgctctttgcactgatgttgacagcagggcttcctgagctcacctcagtcaaggat
atacagtatctgaaggactctcttgccttaggaaagagtgaagaagaagcactcaaacaa
tttaagcagaaatttgatgaggcgctcagggaaagctggactactaaagtgaactggatg
gcccacacagttcgcaaagactaccgatcttaa

KEGG   Oryctolagus cuniculus (rabbit): 100345250
Entry
100345250         CDS       T03373                                 

Gene name
PIK3R3
Definition
(RefSeq) phosphatidylinositol 3-kinase regulatory subunit gamma
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu01521  EGFR tyrosine kinase inhibitor resistance
ocu01522  Endocrine resistance
ocu01524  Platinum drug resistance
ocu04012  ErbB signaling pathway
ocu04014  Ras signaling pathway
ocu04015  Rap1 signaling pathway
ocu04024  cAMP signaling pathway
ocu04062  Chemokine signaling pathway
ocu04066  HIF-1 signaling pathway
ocu04068  FoxO signaling pathway
ocu04070  Phosphatidylinositol signaling system
ocu04071  Sphingolipid signaling pathway
ocu04072  Phospholipase D signaling pathway
ocu04140  Autophagy - animal
ocu04150  mTOR signaling pathway
ocu04151  PI3K-Akt signaling pathway
ocu04152  AMPK signaling pathway
ocu04210  Apoptosis
ocu04211  Longevity regulating pathway
ocu04213  Longevity regulating pathway - multiple species
ocu04218  Cellular senescence
ocu04360  Axon guidance
ocu04370  VEGF signaling pathway
ocu04380  Osteoclast differentiation
ocu04510  Focal adhesion
ocu04550  Signaling pathways regulating pluripotency of stem cells
ocu04611  Platelet activation
ocu04620  Toll-like receptor signaling pathway
ocu04625  C-type lectin receptor signaling pathway
ocu04630  JAK-STAT signaling pathway
ocu04650  Natural killer cell mediated cytotoxicity
ocu04660  T cell receptor signaling pathway
ocu04662  B cell receptor signaling pathway
ocu04664  Fc epsilon RI signaling pathway
ocu04666  Fc gamma R-mediated phagocytosis
ocu04668  TNF signaling pathway
ocu04670  Leukocyte transendothelial migration
ocu04722  Neurotrophin signaling pathway
ocu04725  Cholinergic synapse
ocu04750  Inflammatory mediator regulation of TRP channels
ocu04810  Regulation of actin cytoskeleton
ocu04910  Insulin signaling pathway
ocu04914  Progesterone-mediated oocyte maturation
ocu04915  Estrogen signaling pathway
ocu04917  Prolactin signaling pathway
ocu04919  Thyroid hormone signaling pathway
ocu04923  Regulation of lipolysis in adipocytes
ocu04926  Relaxin signaling pathway
ocu04929  GnRH secretion
ocu04930  Type II diabetes mellitus
ocu04931  Insulin resistance
ocu04932  Non-alcoholic fatty liver disease
ocu04933  AGE-RAGE signaling pathway in diabetic complications
ocu04935  Growth hormone synthesis, secretion and action
ocu04960  Aldosterone-regulated sodium reabsorption
ocu04973  Carbohydrate digestion and absorption
ocu05010  Alzheimer disease
ocu05017  Spinocerebellar ataxia
ocu05020  Prion disease
ocu05100  Bacterial invasion of epithelial cells
ocu05135  Yersinia infection
ocu05142  Chagas disease
ocu05146  Amoebiasis
ocu05160  Hepatitis C
ocu05161  Hepatitis B
ocu05162  Measles
ocu05163  Human cytomegalovirus infection
ocu05164  Influenza A
ocu05165  Human papillomavirus infection
ocu05166  Human T-cell leukemia virus 1 infection
ocu05167  Kaposi sarcoma-associated herpesvirus infection
ocu05168  Herpes simplex virus 1 infection
ocu05169  Epstein-Barr virus infection
ocu05170  Human immunodeficiency virus 1 infection
ocu05200  Pathways in cancer
ocu05203  Viral carcinogenesis
ocu05205  Proteoglycans in cancer
ocu05206  MicroRNAs in cancer
ocu05210  Colorectal cancer
ocu05211  Renal cell carcinoma
ocu05212  Pancreatic cancer
ocu05213  Endometrial cancer
ocu05214  Glioma
ocu05215  Prostate cancer
ocu05218  Melanoma
ocu05220  Chronic myeloid leukemia
ocu05221  Acute myeloid leukemia
ocu05222  Small cell lung cancer
ocu05223  Non-small cell lung cancer
ocu05224  Breast cancer
ocu05225  Hepatocellular carcinoma
ocu05226  Gastric cancer
ocu05230  Central carbon metabolism in cancer
ocu05231  Choline metabolism in cancer
ocu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ocu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100345250 (PIK3R3)
   04014 Ras signaling pathway
    100345250 (PIK3R3)
   04015 Rap1 signaling pathway
    100345250 (PIK3R3)
   04370 VEGF signaling pathway
    100345250 (PIK3R3)
   04630 JAK-STAT signaling pathway
    100345250 (PIK3R3)
   04668 TNF signaling pathway
    100345250 (PIK3R3)
   04066 HIF-1 signaling pathway
    100345250 (PIK3R3)
   04068 FoxO signaling pathway
    100345250 (PIK3R3)
   04070 Phosphatidylinositol signaling system
    100345250 (PIK3R3)
   04072 Phospholipase D signaling pathway
    100345250 (PIK3R3)
   04071 Sphingolipid signaling pathway
    100345250 (PIK3R3)
   04024 cAMP signaling pathway
    100345250 (PIK3R3)
   04151 PI3K-Akt signaling pathway
    100345250 (PIK3R3)
   04152 AMPK signaling pathway
    100345250 (PIK3R3)
   04150 mTOR signaling pathway
    100345250 (PIK3R3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100345250 (PIK3R3)
  09143 Cell growth and death
   04210 Apoptosis
    100345250 (PIK3R3)
   04218 Cellular senescence
    100345250 (PIK3R3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100345250 (PIK3R3)
   04550 Signaling pathways regulating pluripotency of stem cells
    100345250 (PIK3R3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100345250 (PIK3R3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100345250 (PIK3R3)
   04620 Toll-like receptor signaling pathway
    100345250 (PIK3R3)
   04625 C-type lectin receptor signaling pathway
    100345250 (PIK3R3)
   04650 Natural killer cell mediated cytotoxicity
    100345250 (PIK3R3)
   04660 T cell receptor signaling pathway
    100345250 (PIK3R3)
   04662 B cell receptor signaling pathway
    100345250 (PIK3R3)
   04664 Fc epsilon RI signaling pathway
    100345250 (PIK3R3)
   04666 Fc gamma R-mediated phagocytosis
    100345250 (PIK3R3)
   04670 Leukocyte transendothelial migration
    100345250 (PIK3R3)
   04062 Chemokine signaling pathway
    100345250 (PIK3R3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100345250 (PIK3R3)
   04923 Regulation of lipolysis in adipocytes
    100345250 (PIK3R3)
   04929 GnRH secretion
    100345250 (PIK3R3)
   04915 Estrogen signaling pathway
    100345250 (PIK3R3)
   04914 Progesterone-mediated oocyte maturation
    100345250 (PIK3R3)
   04917 Prolactin signaling pathway
    100345250 (PIK3R3)
   04926 Relaxin signaling pathway
    100345250 (PIK3R3)
   04935 Growth hormone synthesis, secretion and action
    100345250 (PIK3R3)
   04919 Thyroid hormone signaling pathway
    100345250 (PIK3R3)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    100345250 (PIK3R3)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100345250 (PIK3R3)
  09156 Nervous system
   04725 Cholinergic synapse
    100345250 (PIK3R3)
   04722 Neurotrophin signaling pathway
    100345250 (PIK3R3)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100345250 (PIK3R3)
  09158 Development and regeneration
   04360 Axon guidance
    100345250 (PIK3R3)
   04380 Osteoclast differentiation
    100345250 (PIK3R3)
  09149 Aging
   04211 Longevity regulating pathway
    100345250 (PIK3R3)
   04213 Longevity regulating pathway - multiple species
    100345250 (PIK3R3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100345250 (PIK3R3)
   05206 MicroRNAs in cancer
    100345250 (PIK3R3)
   05205 Proteoglycans in cancer
    100345250 (PIK3R3)
   05203 Viral carcinogenesis
    100345250 (PIK3R3)
   05230 Central carbon metabolism in cancer
    100345250 (PIK3R3)
   05231 Choline metabolism in cancer
    100345250 (PIK3R3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100345250 (PIK3R3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100345250 (PIK3R3)
   05212 Pancreatic cancer
    100345250 (PIK3R3)
   05225 Hepatocellular carcinoma
    100345250 (PIK3R3)
   05226 Gastric cancer
    100345250 (PIK3R3)
   05214 Glioma
    100345250 (PIK3R3)
   05221 Acute myeloid leukemia
    100345250 (PIK3R3)
   05220 Chronic myeloid leukemia
    100345250 (PIK3R3)
   05218 Melanoma
    100345250 (PIK3R3)
   05211 Renal cell carcinoma
    100345250 (PIK3R3)
   05215 Prostate cancer
    100345250 (PIK3R3)
   05213 Endometrial cancer
    100345250 (PIK3R3)
   05224 Breast cancer
    100345250 (PIK3R3)
   05222 Small cell lung cancer
    100345250 (PIK3R3)
   05223 Non-small cell lung cancer
    100345250 (PIK3R3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100345250 (PIK3R3)
   05017 Spinocerebellar ataxia
    100345250 (PIK3R3)
   05020 Prion disease
    100345250 (PIK3R3)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100345250 (PIK3R3)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100345250 (PIK3R3)
   04932 Non-alcoholic fatty liver disease
    100345250 (PIK3R3)
   04931 Insulin resistance
    100345250 (PIK3R3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100345250 (PIK3R3)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100345250 (PIK3R3)
   05100 Bacterial invasion of epithelial cells
    100345250 (PIK3R3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100345250 (PIK3R3)
   05170 Human immunodeficiency virus 1 infection
    100345250 (PIK3R3)
   05162 Measles
    100345250 (PIK3R3)
   05164 Influenza A
    100345250 (PIK3R3)
   05161 Hepatitis B
    100345250 (PIK3R3)
   05160 Hepatitis C
    100345250 (PIK3R3)
   05168 Herpes simplex virus 1 infection
    100345250 (PIK3R3)
   05163 Human cytomegalovirus infection
    100345250 (PIK3R3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100345250 (PIK3R3)
   05169 Epstein-Barr virus infection
    100345250 (PIK3R3)
   05165 Human papillomavirus infection
    100345250 (PIK3R3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100345250 (PIK3R3)
   05142 Chagas disease
    100345250 (PIK3R3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100345250 (PIK3R3)
   01524 Platinum drug resistance
    100345250 (PIK3R3)
   01522 Endocrine resistance
    100345250 (PIK3R3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100345250 (PIK3R3)
Membrane trafficking [BR:ocu04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    100345250 (PIK3R3)
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 Transcrip_act Fez1 DUF5638 PI_PP_I
Other DBs
NCBI-GeneID: 100345250
NCBI-ProteinID: XP_017201822
Ensembl: ENSOCUG00000014319
UniProt: G1T758
LinkDB
Position
13
AA seq 461 aa
MYNTVWSMDRDDADWREVMMPYSTELIFYIEMDPPALPPKPPKPMTSAVTNGMKDSSVSL
QDAEWYWGDISREEVNDKLRDMPDGTFLVRDASTKMQGDYTLTLRKGGNNKLIKIYHRDG
KYGFSDPLTFNSVVELINHYHHESLAQYNPKLDVKLMYPVSRYQQDQLVKEDNIDAVGKK
LQEYHSQYQEKSKEYDRLYEEYTRTSQEIQMKRTAIEAFNETIKIFEEQCHTQEQHSKEY
IERFRREGNEKEIERIMMNYDKLKSRLGEIHDSKMRLEQDLKKQALDNREIDKKMNSIKP
DLIQLRKIRDQHLVWLNHKGVRQKRLNAWLGIKNEDADETYFINEEDENLPHYDEKTWFV
EDINRVQAEDLLYGKPDGAFLIRESSKKGCYACSVVADGEVKHCVIYSTARGYGFAEPYN
LYSSLKELVLHYQHTSLVQHNDSLNVRLAYPVHAQMPSLCR
NT seq 1386 nt   +upstreamnt  +downstreamnt
atgtacaatacggtgtggagtatggaccgcgatgacgcagactggagggaggtgatgatg
ccctattcgacagaactgatattttatattgaaatggatcctccagctcttccaccaaag
ccacctaagccaatgacttcagcagttacaaatggaatgaaagacagttctgtttctctc
caggatgcagaatggtactggggggatatttcaagagaggaggtaaatgacaaattacgg
gacatgccagatggtaccttcttggtccgagatgcctcaacaaagatgcagggggattat
actttgacattgcggaagggaggcaataataagttaataaagatctatcatcgggatggt
aaatatggcttttctgatcctctgacatttaattctgttgtggagctcattaaccactat
catcatgaatctcttgctcagtacaatcccaaacttgacgtgaagctaatgtacccagta
tccagataccaacaggatcagttggtaaaagaagacaacattgatgcagtaggtaaaaaa
ctacaagagtaccactctcagtatcaggaaaagagtaaggaatatgatagattatatgaa
gaatataccagaacatcccaggaaatacagatgaagaggactgcaattgaagcttttaat
gaaacaattaaaatatttgaggagcagtgtcacacacaagaacaacatagcaaagaatat
attgagcgatttcgtagggaggggaatgaaaaggagattgaacgaattatgatgaattat
gacaagttgaaatcacgtctgggtgagattcacgatagcaaaatgcgtcttgagcaggat
ttgaagaaacaagctttggacaaccgagaaatagataaaaaaatgaatagtatcaaacct
gacctgattcagctgcgcaagatccgagatcagcaccttgtgtggctcaatcacaaagga
gtgaggcagaagcgcctgaatgcctggctgggaatcaagaatgaggatgccgatgaaacc
tattttatcaatgaggaagatgaaaacctgccacattatgatgagaaaacctggttcgtt
gaggatatcaatcgagtacaagcagaggacttgctttatgggaaacccgatggtgcattc
ttaattcgtgagagtagcaagaaaggatgctatgcttgctctgtggtcgctgacggggag
gtgaagcactgtgtgatctacagcaccgcgcggggctacggctttgcagagccctacaac
ctgtacagctcgctgaaggagctggtgctccattaccagcacacgtccctggttcagcac
aacgactccctcaacgtcaggctcgcctaccccgtccacgcacagatgccctcgctctgc
agataa

KEGG   Oryctolagus cuniculus (rabbit): 100348663
Entry
100348663         CDS       T03373                                 

Gene name
PIK3CD
Definition
(RefSeq) phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit delta
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu00562  Inositol phosphate metabolism
ocu01100  Metabolic pathways
ocu01521  EGFR tyrosine kinase inhibitor resistance
ocu01522  Endocrine resistance
ocu01524  Platinum drug resistance
ocu04012  ErbB signaling pathway
ocu04014  Ras signaling pathway
ocu04015  Rap1 signaling pathway
ocu04024  cAMP signaling pathway
ocu04062  Chemokine signaling pathway
ocu04066  HIF-1 signaling pathway
ocu04068  FoxO signaling pathway
ocu04070  Phosphatidylinositol signaling system
ocu04071  Sphingolipid signaling pathway
ocu04072  Phospholipase D signaling pathway
ocu04140  Autophagy - animal
ocu04150  mTOR signaling pathway
ocu04151  PI3K-Akt signaling pathway
ocu04152  AMPK signaling pathway
ocu04210  Apoptosis
ocu04211  Longevity regulating pathway
ocu04213  Longevity regulating pathway - multiple species
ocu04218  Cellular senescence
ocu04360  Axon guidance
ocu04370  VEGF signaling pathway
ocu04380  Osteoclast differentiation
ocu04510  Focal adhesion
ocu04550  Signaling pathways regulating pluripotency of stem cells
ocu04611  Platelet activation
ocu04620  Toll-like receptor signaling pathway
ocu04625  C-type lectin receptor signaling pathway
ocu04630  JAK-STAT signaling pathway
ocu04650  Natural killer cell mediated cytotoxicity
ocu04660  T cell receptor signaling pathway
ocu04662  B cell receptor signaling pathway
ocu04664  Fc epsilon RI signaling pathway
ocu04666  Fc gamma R-mediated phagocytosis
ocu04668  TNF signaling pathway
ocu04670  Leukocyte transendothelial migration
ocu04722  Neurotrophin signaling pathway
ocu04725  Cholinergic synapse
ocu04750  Inflammatory mediator regulation of TRP channels
ocu04810  Regulation of actin cytoskeleton
ocu04910  Insulin signaling pathway
ocu04914  Progesterone-mediated oocyte maturation
ocu04915  Estrogen signaling pathway
ocu04917  Prolactin signaling pathway
ocu04919  Thyroid hormone signaling pathway
ocu04923  Regulation of lipolysis in adipocytes
ocu04926  Relaxin signaling pathway
ocu04929  GnRH secretion
ocu04930  Type II diabetes mellitus
ocu04931  Insulin resistance
ocu04932  Non-alcoholic fatty liver disease
ocu04933  AGE-RAGE signaling pathway in diabetic complications
ocu04935  Growth hormone synthesis, secretion and action
ocu04960  Aldosterone-regulated sodium reabsorption
ocu04973  Carbohydrate digestion and absorption
ocu05010  Alzheimer disease
ocu05017  Spinocerebellar ataxia
ocu05020  Prion disease
ocu05100  Bacterial invasion of epithelial cells
ocu05132  Salmonella infection
ocu05135  Yersinia infection
ocu05142  Chagas disease
ocu05146  Amoebiasis
ocu05160  Hepatitis C
ocu05161  Hepatitis B
ocu05162  Measles
ocu05163  Human cytomegalovirus infection
ocu05164  Influenza A
ocu05165  Human papillomavirus infection
ocu05166  Human T-cell leukemia virus 1 infection
ocu05167  Kaposi sarcoma-associated herpesvirus infection
ocu05168  Herpes simplex virus 1 infection
ocu05169  Epstein-Barr virus infection
ocu05170  Human immunodeficiency virus 1 infection
ocu05200  Pathways in cancer
ocu05203  Viral carcinogenesis
ocu05205  Proteoglycans in cancer
ocu05206  MicroRNAs in cancer
ocu05210  Colorectal cancer
ocu05211  Renal cell carcinoma
ocu05212  Pancreatic cancer
ocu05213  Endometrial cancer
ocu05214  Glioma
ocu05215  Prostate cancer
ocu05218  Melanoma
ocu05220  Chronic myeloid leukemia
ocu05221  Acute myeloid leukemia
ocu05222  Small cell lung cancer
ocu05223  Non-small cell lung cancer
ocu05224  Breast cancer
ocu05225  Hepatocellular carcinoma
ocu05226  Gastric cancer
ocu05230  Central carbon metabolism in cancer
ocu05231  Choline metabolism in cancer
ocu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ocu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100348663 (PIK3CD)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100348663 (PIK3CD)
   04014 Ras signaling pathway
    100348663 (PIK3CD)
   04015 Rap1 signaling pathway
    100348663 (PIK3CD)
   04370 VEGF signaling pathway
    100348663 (PIK3CD)
   04630 JAK-STAT signaling pathway
    100348663 (PIK3CD)
   04668 TNF signaling pathway
    100348663 (PIK3CD)
   04066 HIF-1 signaling pathway
    100348663 (PIK3CD)
   04068 FoxO signaling pathway
    100348663 (PIK3CD)
   04070 Phosphatidylinositol signaling system
    100348663 (PIK3CD)
   04072 Phospholipase D signaling pathway
    100348663 (PIK3CD)
   04071 Sphingolipid signaling pathway
    100348663 (PIK3CD)
   04024 cAMP signaling pathway
    100348663 (PIK3CD)
   04151 PI3K-Akt signaling pathway
    100348663 (PIK3CD)
   04152 AMPK signaling pathway
    100348663 (PIK3CD)
   04150 mTOR signaling pathway
    100348663 (PIK3CD)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100348663 (PIK3CD)
  09143 Cell growth and death
   04210 Apoptosis
    100348663 (PIK3CD)
   04218 Cellular senescence
    100348663 (PIK3CD)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100348663 (PIK3CD)
   04550 Signaling pathways regulating pluripotency of stem cells
    100348663 (PIK3CD)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100348663 (PIK3CD)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100348663 (PIK3CD)
   04620 Toll-like receptor signaling pathway
    100348663 (PIK3CD)
   04625 C-type lectin receptor signaling pathway
    100348663 (PIK3CD)
   04650 Natural killer cell mediated cytotoxicity
    100348663 (PIK3CD)
   04660 T cell receptor signaling pathway
    100348663 (PIK3CD)
   04662 B cell receptor signaling pathway
    100348663 (PIK3CD)
   04664 Fc epsilon RI signaling pathway
    100348663 (PIK3CD)
   04666 Fc gamma R-mediated phagocytosis
    100348663 (PIK3CD)
   04670 Leukocyte transendothelial migration
    100348663 (PIK3CD)
   04062 Chemokine signaling pathway
    100348663 (PIK3CD)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100348663 (PIK3CD)
   04923 Regulation of lipolysis in adipocytes
    100348663 (PIK3CD)
   04929 GnRH secretion
    100348663 (PIK3CD)
   04915 Estrogen signaling pathway
    100348663 (PIK3CD)
   04914 Progesterone-mediated oocyte maturation
    100348663 (PIK3CD)
   04917 Prolactin signaling pathway
    100348663 (PIK3CD)
   04926 Relaxin signaling pathway
    100348663 (PIK3CD)
   04935 Growth hormone synthesis, secretion and action
    100348663 (PIK3CD)
   04919 Thyroid hormone signaling pathway
    100348663 (PIK3CD)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    100348663 (PIK3CD)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100348663 (PIK3CD)
  09156 Nervous system
   04725 Cholinergic synapse
    100348663 (PIK3CD)
   04722 Neurotrophin signaling pathway
    100348663 (PIK3CD)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100348663 (PIK3CD)
  09158 Development and regeneration
   04360 Axon guidance
    100348663 (PIK3CD)
   04380 Osteoclast differentiation
    100348663 (PIK3CD)
  09149 Aging
   04211 Longevity regulating pathway
    100348663 (PIK3CD)
   04213 Longevity regulating pathway - multiple species
    100348663 (PIK3CD)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100348663 (PIK3CD)
   05206 MicroRNAs in cancer
    100348663 (PIK3CD)
   05205 Proteoglycans in cancer
    100348663 (PIK3CD)
   05203 Viral carcinogenesis
    100348663 (PIK3CD)
   05230 Central carbon metabolism in cancer
    100348663 (PIK3CD)
   05231 Choline metabolism in cancer
    100348663 (PIK3CD)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100348663 (PIK3CD)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100348663 (PIK3CD)
   05212 Pancreatic cancer
    100348663 (PIK3CD)
   05225 Hepatocellular carcinoma
    100348663 (PIK3CD)
   05226 Gastric cancer
    100348663 (PIK3CD)
   05214 Glioma
    100348663 (PIK3CD)
   05221 Acute myeloid leukemia
    100348663 (PIK3CD)
   05220 Chronic myeloid leukemia
    100348663 (PIK3CD)
   05218 Melanoma
    100348663 (PIK3CD)
   05211 Renal cell carcinoma
    100348663 (PIK3CD)
   05215 Prostate cancer
    100348663 (PIK3CD)
   05213 Endometrial cancer
    100348663 (PIK3CD)
   05224 Breast cancer
    100348663 (PIK3CD)
   05222 Small cell lung cancer
    100348663 (PIK3CD)
   05223 Non-small cell lung cancer
    100348663 (PIK3CD)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100348663 (PIK3CD)
   05017 Spinocerebellar ataxia
    100348663 (PIK3CD)
   05020 Prion disease
    100348663 (PIK3CD)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100348663 (PIK3CD)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100348663 (PIK3CD)
   04932 Non-alcoholic fatty liver disease
    100348663 (PIK3CD)
   04931 Insulin resistance
    100348663 (PIK3CD)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100348663 (PIK3CD)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100348663 (PIK3CD)
   05135 Yersinia infection
    100348663 (PIK3CD)
   05100 Bacterial invasion of epithelial cells
    100348663 (PIK3CD)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100348663 (PIK3CD)
   05170 Human immunodeficiency virus 1 infection
    100348663 (PIK3CD)
   05162 Measles
    100348663 (PIK3CD)
   05164 Influenza A
    100348663 (PIK3CD)
   05161 Hepatitis B
    100348663 (PIK3CD)
   05160 Hepatitis C
    100348663 (PIK3CD)
   05168 Herpes simplex virus 1 infection
    100348663 (PIK3CD)
   05163 Human cytomegalovirus infection
    100348663 (PIK3CD)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100348663 (PIK3CD)
   05169 Epstein-Barr virus infection
    100348663 (PIK3CD)
   05165 Human papillomavirus infection
    100348663 (PIK3CD)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100348663 (PIK3CD)
   05142 Chagas disease
    100348663 (PIK3CD)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100348663 (PIK3CD)
   01524 Platinum drug resistance
    100348663 (PIK3CD)
   01522 Endocrine resistance
    100348663 (PIK3CD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100348663 (PIK3CD)
Enzymes [BR:ocu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     100348663 (PIK3CD)
Membrane trafficking [BR:ocu04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    100348663 (PIK3CD)
SSDB
Motif
Pfam: PI3_PI4_kinase PI3Ka PI3K_rbd PI3K_C2 PI3K_p85B
Other DBs
NCBI-GeneID: 100348663
NCBI-ProteinID: XP_008264167
Ensembl: ENSOCUG00000011054
LinkDB
Position
13
AA seq 1052 aa
MPPGVDCPMEFWTKEENQNVAVDFLLPTGIYLNFPVSRNANLSTIKQVQARGALVGAQYE
PLFHMLSDPEAYVFTCVSQTAEPQELEDEQRRLCDVQPFLPPFLPVLRLVAREGDRVKKL
INSQISLLIGKGLHEFDSLRDPEVNDFRTKMRQFCEEAAVRRQQLGWEAWLQYSFPLQLE
PSARSWGAGALHAPNRALLVNVKFEGSEESFTFQVSTKDMPLALMACALRKKATVFRQPL
AEQPEDYTLQVNGRHEYLYGSYALCQFQYIRSCLHSGLTPHLTMVHSSSILAMRDEQSSP
APQVQKPRTKPPPVPMKKPSSVSLWSLEQPFCIELVQGSRVNADERMKLVVQAGFFHGNE
TLCKTVSSAEVSVSSEPVWKQRLEFDISICDLPRMARLCFALYAVVEKAKKARSTKKKSK
KADCPIAWANLMLFDYKDQLKTGERCLYMWPSVPDEKGELLNPTGTVRGNPNTESAAALV
ICLPEVAPHPVYYPPLEKILELGRHGERAPTSEEEQLQLREILERRGSGELYEHEKDLVW
KMRHEVQERFPEALARLLLVTKWNKHEDVAQMLHLLCSWPELPVLSALELLDFSFPDCHV
GSFAIKSLRKLTDEELFQYLLQLVQVLKYESYLDCELTKFLLGRALANRKIGHFLFWHLR
SEMHVPSVALRFGLIMEAYCRGSTHHMKVLMKQGEALSKLKALNDFVKVSSQKTTKPQTK
ELMHLCMRQEAYLEALSHLQSPLDPSTLLAEVCVEQCTFMDSKMKPLWIVYSNEEAGSEG
SVGIIFKNGDDLRQDMLTLQMIQLMDVLWKQEGLDLRMTPYGCLPTGDRTGLIEVVLHSD
TIANIQLNKSNMAATAAFNKDALLNWLKSKNPGEALDRAIEEFTLSCAGYCVATYVLGIG
DRHSDNIMIRESGQLFHVDFGHFLGNFKTKFGINRERVPFILTYDFVHVIQQGKTNNSEK
FERFRGYCERAYTILRRHGLLFLHLFALMRAAGLPELSCPKDIQYLKDSLALGKTEEEAL
KHFRVKFNEALRESWKTKVNWLAHNVSKDNRQ
NT seq 3159 nt   +upstreamnt  +downstreamnt
atgccccctggggttgactgccccatggaattctggaccaaggaagagaatcagaatgtg
gcggtggacttcctgctgcccacgggcatctacctcaacttccccgtgtcccgcaatgcc
aacctcagcaccatcaagcaggtacaggcccggggcgccctggtgggtgcgcagtacgag
ccactgttccacatgctcagtgaccccgaggcctacgtgttcacgtgcgtcagccagacg
gcagagccgcaggagctggaggacgagcagcggcggctgtgcgacgtgcagcccttcctg
ccccccttcctgcccgtgctgcgcctggtggcccgcgagggcgaccgcgtgaagaagctc
atcaactcgcagatcagcctgctcatcggcaaaggcctccatgagttcgactccctgcgc
gacccagaggtcaacgacttccgcaccaagatgcgccagttctgcgaggaggcggccgtg
cgcaggcagcagctgggctgggaggcctggctgcagtacagcttccccctgcagctggag
ccctcggcacgcagctggggggccggcgccctgcacgcccccaaccgggccctgctggtc
aatgtcaagttcgagggcagtgaggagagcttcactttccaggtgtccaccaaggacatg
cccctggcactgatggcctgcgccctccggaagaaggccacggtgttccggcagcccctg
gccgaacagccagaggactacacgctgcaggtgaacgggcggcacgagtacctgtacggc
agctacgccctctgccagttccagtacatccgcagctgcctgcacagcgggctcaccccg
cacctgaccatggtgcactcctcctccatcctggccatgcgggacgagcagagcagcccc
gcccctcaggtccagaaacctcgcaccaagccgccccccgttcccatgaagaagccctcc
tctgtgtcgctgtggtcgctggagcagcccttctgcatcgagctggtccagggcagcagg
gtgaatgccgatgagcggatgaagctggtggtgcaggccgggttcttccacggcaacgag
acgctgtgcaagacggtgtccagcgcggaggtgagcgtgagctccgagcccgtgtggaag
cagcggctggagtttgacatcagcatctgcgacctgccgcgcatggcccggctctgcttc
gcgctctacgccgtggttgagaaggccaagaaggcgcgctccaccaagaagaagtccaag
aaggcggactgccccatcgcctgggccaacctcatgctcttcgactacaaggaccagctc
aagaccggggagcgctgcctctacatgtggccctctgtcccagacgagaaaggggagctg
ctgaaccccacggggaccgtgcgtggtaaccccaacactgagagcgccgccgccctggtc
atctgcctgcccgaggtggccccccaccctgtgtactacccgcccctggagaagatcctg
gagctggggcgacacggggagcgagcgcccacctcggaggaggagcagctgcagctgcgg
gagatcctggagcgacgggggtccggggagctgtacgagcacgagaaggacctggtgtgg
aagatgcggcacgaagtccaggagcgcttcccggaggcgctggcccggctgctgctggtc
accaagtggaacaaacatgaggatgtggcccagatgctgcacctgctgtgctcctggccc
gagctgcccgtgctgagtgccctggagctgctggacttcagcttccccgactgccacgtg
ggctcctttgccatcaagtccctgcggaagctgacggatgaggagcttttccagtacctg
ctgcagctggtacaggtgctcaagtacgagtcctacctggactgcgagctgaccaagttc
ttgctgggccgggccctggccaaccgcaagatcggccacttcctcttctggcacctccgc
tccgagatgcacgtgccctccgtggctttgcgcttcggcctcatcatggaggcctactgc
aggggcagcacccatcacatgaaggtgctgatgaagcagggggaagcactgagcaagctg
aaggccctgaatgacttcgtcaaggtgagctctcagaagaccaccaagccgcagaccaag
gagctgatgcacctgtgcatgcgccaggaggcctacctggaggccctctcgcacctgcag
tccccgctcgaccccagcaccctgctggccgaagtctgcgtggagcagtgcaccttcatg
gactccaagatgaagcccctgtggatcgtgtacagcaacgaggaggcgggcagcgagggc
agcgtgggcatcatcttcaagaacggggacgacctccgccaggacatgctgaccctgcag
atgatccagctcatggacgtcctgtggaagcaggagggcctggacttgaggatgaccccc
tatggctgcctccccacgggggaccgcacaggcctgatcgaggtagttctccactcggac
accattgccaacatccagctgaacaagagcaacatggcggccacggctgccttcaacaag
gacgctctgctcaactggctcaagtccaagaaccctggggaggccctggaccgtgccatt
gaggagttcaccctctcctgtgccggctactgtgtggccacatacgtgctgggcatcggc
gaccggcacagtgacaacatcatgatccgtgagagtggacagctgttccatgttgacttc
ggtcacttcctggggaatttcaagaccaagttcggaatcaaccgtgagcgagtccccttc
atcctcacctacgactttgtccacgtgattcagcaggggaagaccaacaacagtgagaag
tttgaaaggttccggggctactgtgagagagcgtacaccatcctgcggcgccacgggctc
ctcttcctccacctctttgccctgatgcgggcagcgggcctccccgagctcagctgcccc
aaagacatccagtatctcaaggactccctggccctggggaagacggaggaggaggcactg
aagcacttccgggtgaagtttaatgaagccctgcgggagagctggaagaccaaagtgaac
tggctggcccacaatgtgtccaaagacaatcggcagtag

KEGG   Oryctolagus cuniculus (rabbit): 100357841
Entry
100357841         CDS       T03373                                 

Gene name
PIK3R1
Definition
(RefSeq) phosphoinositide-3-kinase regulatory subunit 1
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu01521  EGFR tyrosine kinase inhibitor resistance
ocu01522  Endocrine resistance
ocu01524  Platinum drug resistance
ocu04012  ErbB signaling pathway
ocu04014  Ras signaling pathway
ocu04015  Rap1 signaling pathway
ocu04024  cAMP signaling pathway
ocu04062  Chemokine signaling pathway
ocu04066  HIF-1 signaling pathway
ocu04068  FoxO signaling pathway
ocu04070  Phosphatidylinositol signaling system
ocu04071  Sphingolipid signaling pathway
ocu04072  Phospholipase D signaling pathway
ocu04140  Autophagy - animal
ocu04150  mTOR signaling pathway
ocu04151  PI3K-Akt signaling pathway
ocu04152  AMPK signaling pathway
ocu04210  Apoptosis
ocu04211  Longevity regulating pathway
ocu04213  Longevity regulating pathway - multiple species
ocu04218  Cellular senescence
ocu04360  Axon guidance
ocu04370  VEGF signaling pathway
ocu04380  Osteoclast differentiation
ocu04510  Focal adhesion
ocu04550  Signaling pathways regulating pluripotency of stem cells
ocu04611  Platelet activation
ocu04620  Toll-like receptor signaling pathway
ocu04625  C-type lectin receptor signaling pathway
ocu04630  JAK-STAT signaling pathway
ocu04650  Natural killer cell mediated cytotoxicity
ocu04660  T cell receptor signaling pathway
ocu04662  B cell receptor signaling pathway
ocu04664  Fc epsilon RI signaling pathway
ocu04666  Fc gamma R-mediated phagocytosis
ocu04668  TNF signaling pathway
ocu04670  Leukocyte transendothelial migration
ocu04722  Neurotrophin signaling pathway
ocu04725  Cholinergic synapse
ocu04750  Inflammatory mediator regulation of TRP channels
ocu04810  Regulation of actin cytoskeleton
ocu04910  Insulin signaling pathway
ocu04914  Progesterone-mediated oocyte maturation
ocu04915  Estrogen signaling pathway
ocu04917  Prolactin signaling pathway
ocu04919  Thyroid hormone signaling pathway
ocu04923  Regulation of lipolysis in adipocytes
ocu04926  Relaxin signaling pathway
ocu04929  GnRH secretion
ocu04930  Type II diabetes mellitus
ocu04931  Insulin resistance
ocu04932  Non-alcoholic fatty liver disease
ocu04933  AGE-RAGE signaling pathway in diabetic complications
ocu04935  Growth hormone synthesis, secretion and action
ocu04960  Aldosterone-regulated sodium reabsorption
ocu04973  Carbohydrate digestion and absorption
ocu05010  Alzheimer disease
ocu05017  Spinocerebellar ataxia
ocu05020  Prion disease
ocu05100  Bacterial invasion of epithelial cells
ocu05135  Yersinia infection
ocu05142  Chagas disease
ocu05146  Amoebiasis
ocu05160  Hepatitis C
ocu05161  Hepatitis B
ocu05162  Measles
ocu05163  Human cytomegalovirus infection
ocu05164  Influenza A
ocu05165  Human papillomavirus infection
ocu05166  Human T-cell leukemia virus 1 infection
ocu05167  Kaposi sarcoma-associated herpesvirus infection
ocu05168  Herpes simplex virus 1 infection
ocu05169  Epstein-Barr virus infection
ocu05170  Human immunodeficiency virus 1 infection
ocu05200  Pathways in cancer
ocu05203  Viral carcinogenesis
ocu05205  Proteoglycans in cancer
ocu05206  MicroRNAs in cancer
ocu05210  Colorectal cancer
ocu05211  Renal cell carcinoma
ocu05212  Pancreatic cancer
ocu05213  Endometrial cancer
ocu05214  Glioma
ocu05215  Prostate cancer
ocu05218  Melanoma
ocu05220  Chronic myeloid leukemia
ocu05221  Acute myeloid leukemia
ocu05222  Small cell lung cancer
ocu05223  Non-small cell lung cancer
ocu05224  Breast cancer
ocu05225  Hepatocellular carcinoma
ocu05226  Gastric cancer
ocu05230  Central carbon metabolism in cancer
ocu05231  Choline metabolism in cancer
ocu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ocu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100357841 (PIK3R1)
   04014 Ras signaling pathway
    100357841 (PIK3R1)
   04015 Rap1 signaling pathway
    100357841 (PIK3R1)
   04370 VEGF signaling pathway
    100357841 (PIK3R1)
   04630 JAK-STAT signaling pathway
    100357841 (PIK3R1)
   04668 TNF signaling pathway
    100357841 (PIK3R1)
   04066 HIF-1 signaling pathway
    100357841 (PIK3R1)
   04068 FoxO signaling pathway
    100357841 (PIK3R1)
   04070 Phosphatidylinositol signaling system
    100357841 (PIK3R1)
   04072 Phospholipase D signaling pathway
    100357841 (PIK3R1)
   04071 Sphingolipid signaling pathway
    100357841 (PIK3R1)
   04024 cAMP signaling pathway
    100357841 (PIK3R1)
   04151 PI3K-Akt signaling pathway
    100357841 (PIK3R1)
   04152 AMPK signaling pathway
    100357841 (PIK3R1)
   04150 mTOR signaling pathway
    100357841 (PIK3R1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100357841 (PIK3R1)
  09143 Cell growth and death
   04210 Apoptosis
    100357841 (PIK3R1)
   04218 Cellular senescence
    100357841 (PIK3R1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100357841 (PIK3R1)
   04550 Signaling pathways regulating pluripotency of stem cells
    100357841 (PIK3R1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100357841 (PIK3R1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100357841 (PIK3R1)
   04620 Toll-like receptor signaling pathway
    100357841 (PIK3R1)
   04625 C-type lectin receptor signaling pathway
    100357841 (PIK3R1)
   04650 Natural killer cell mediated cytotoxicity
    100357841 (PIK3R1)
   04660 T cell receptor signaling pathway
    100357841 (PIK3R1)
   04662 B cell receptor signaling pathway
    100357841 (PIK3R1)
   04664 Fc epsilon RI signaling pathway
    100357841 (PIK3R1)
   04666 Fc gamma R-mediated phagocytosis
    100357841 (PIK3R1)
   04670 Leukocyte transendothelial migration
    100357841 (PIK3R1)
   04062 Chemokine signaling pathway
    100357841 (PIK3R1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100357841 (PIK3R1)
   04923 Regulation of lipolysis in adipocytes
    100357841 (PIK3R1)
   04929 GnRH secretion
    100357841 (PIK3R1)
   04915 Estrogen signaling pathway
    100357841 (PIK3R1)
   04914 Progesterone-mediated oocyte maturation
    100357841 (PIK3R1)
   04917 Prolactin signaling pathway
    100357841 (PIK3R1)
   04926 Relaxin signaling pathway
    100357841 (PIK3R1)
   04935 Growth hormone synthesis, secretion and action
    100357841 (PIK3R1)
   04919 Thyroid hormone signaling pathway
    100357841 (PIK3R1)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    100357841 (PIK3R1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100357841 (PIK3R1)
  09156 Nervous system
   04725 Cholinergic synapse
    100357841 (PIK3R1)
   04722 Neurotrophin signaling pathway
    100357841 (PIK3R1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100357841 (PIK3R1)
  09158 Development and regeneration
   04360 Axon guidance
    100357841 (PIK3R1)
   04380 Osteoclast differentiation
    100357841 (PIK3R1)
  09149 Aging
   04211 Longevity regulating pathway
    100357841 (PIK3R1)
   04213 Longevity regulating pathway - multiple species
    100357841 (PIK3R1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100357841 (PIK3R1)
   05206 MicroRNAs in cancer
    100357841 (PIK3R1)
   05205 Proteoglycans in cancer
    100357841 (PIK3R1)
   05203 Viral carcinogenesis
    100357841 (PIK3R1)
   05230 Central carbon metabolism in cancer
    100357841 (PIK3R1)
   05231 Choline metabolism in cancer
    100357841 (PIK3R1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100357841 (PIK3R1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100357841 (PIK3R1)
   05212 Pancreatic cancer
    100357841 (PIK3R1)
   05225 Hepatocellular carcinoma
    100357841 (PIK3R1)
   05226 Gastric cancer
    100357841 (PIK3R1)
   05214 Glioma
    100357841 (PIK3R1)
   05221 Acute myeloid leukemia
    100357841 (PIK3R1)
   05220 Chronic myeloid leukemia
    100357841 (PIK3R1)
   05218 Melanoma
    100357841 (PIK3R1)
   05211 Renal cell carcinoma
    100357841 (PIK3R1)
   05215 Prostate cancer
    100357841 (PIK3R1)
   05213 Endometrial cancer
    100357841 (PIK3R1)
   05224 Breast cancer
    100357841 (PIK3R1)
   05222 Small cell lung cancer
    100357841 (PIK3R1)
   05223 Non-small cell lung cancer
    100357841 (PIK3R1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100357841 (PIK3R1)
   05017 Spinocerebellar ataxia
    100357841 (PIK3R1)
   05020 Prion disease
    100357841 (PIK3R1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100357841 (PIK3R1)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100357841 (PIK3R1)
   04932 Non-alcoholic fatty liver disease
    100357841 (PIK3R1)
   04931 Insulin resistance
    100357841 (PIK3R1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100357841 (PIK3R1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100357841 (PIK3R1)
   05100 Bacterial invasion of epithelial cells
    100357841 (PIK3R1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100357841 (PIK3R1)
   05170 Human immunodeficiency virus 1 infection
    100357841 (PIK3R1)
   05162 Measles
    100357841 (PIK3R1)
   05164 Influenza A
    100357841 (PIK3R1)
   05161 Hepatitis B
    100357841 (PIK3R1)
   05160 Hepatitis C
    100357841 (PIK3R1)
   05168 Herpes simplex virus 1 infection
    100357841 (PIK3R1)
   05163 Human cytomegalovirus infection
    100357841 (PIK3R1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100357841 (PIK3R1)
   05169 Epstein-Barr virus infection
    100357841 (PIK3R1)
   05165 Human papillomavirus infection
    100357841 (PIK3R1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100357841 (PIK3R1)
   05142 Chagas disease
    100357841 (PIK3R1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100357841 (PIK3R1)
   01524 Platinum drug resistance
    100357841 (PIK3R1)
   01522 Endocrine resistance
    100357841 (PIK3R1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100357841 (PIK3R1)
Membrane trafficking [BR:ocu04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    100357841 (PIK3R1)
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 RhoGAP SH3_1 SH3_9 SH3_2 Laminin_I Lant_dehydr_C Mod_r PI_PP_I Bap31_Bap29_C
Other DBs
NCBI-GeneID: 100357841
NCBI-ProteinID: XP_002714116
Ensembl: ENSOCUG00000005116
UniProt: G1SN87
LinkDB
Position
11
AA seq 724 aa
MSAEGYQYRALYDYKKERDEDIDLHLGDILTVNKGSLVALGFSEGQEARPEDIGWLNGYN
ETTGERGDFPGTYVEYIGRKRISPPTPKPRPPRPLPVAPGSAKSEADSEPPASTLPDLAE
QFAPPDVAPPLLIKLLEAIEKKGLECSTLYRTPSSSNPAELRQLLDCDAASVDLEAMDVQ
VLADAFKRYLLDLPNPVIPVAVYSEMLSLAQEIQSAEEYTQVLKKLIRSPNIPHQYWLTL
QYLLKHFFRLSQASSKSLLTARALAEIFSPMLFRFPAASPDNTEHLVKVIEILICNEWSD
RQPAPALPPKPPKPTTVANNGTNNNMSLQDAEWYWGDISREEVNEKLRDTADGTFLVRDA
STKMHGDYTLTLRKGGNNKLIKIFHRDGKYGFSDPLTFNSVVELINHYRNESLAQYNPKL
DVKLLYPVSKYQQDQVVKEDNIEAVGKKLHEYNTQFQEKSREYDRLYEEYTRTSQEIQMK
RTAIEAFNETIKIFEEQCQTQERYSKEYIEKFKREGNEKEIQRIMHNYDKLKSRISEIID
SRRRLEEDLKKQAAEYREIDKRMNSIKPDLIQLRKTRDQYLMWLTQKGVRQKKLNEWLGN
ENTEDQYSLVEDDEDLPHHDEKTWNVGSSNRNKAETLLRGKRDGTFLVRESSKQGCYACS
VVVDGEVKHCVINKTATGYGFAEPYNLYSSLKELVLHYQHTSLVQHNDSLNVTLAYPVYA
QQRR
NT seq 2175 nt   +upstreamnt  +downstreamnt
atgagtgccgagggctaccagtaccgggcgctgtacgactacaagaaggagagggacgag
gacatcgacttgcacttgggggacatactgactgtgaacaaagggtccttggtggcgctg
ggcttcagcgaggggcaggaagcccggcccgaagacatcggctggctaaacggctataat
gagaccacgggggagaggggcgacttcccggggacctacgtggaatacatcggaaggaag
agaatctcgcctcctactccgaagccccggccgcctcgaccccttcctgttgcgccaggt
tctgccaaatccgaggcggacagtgagccaccagcttccacgcttccggatcttgcagag
cagttcgcccctcccgacgttgccccgcctcttcttatcaagctcttggaagccattgag
aagaaaggtctggaatgttcaaccctctacaggacgccgagctccagcaaccctgcagaa
ctacgacagcttcttgattgtgacgcagcctccgtggacctggaagcgatggatgtgcaa
gtgttagccgatgctttcaaacgctatctcctggacttacccaatcccgtcatccccgta
gccgtgtacagcgagatgctttccttagcccaagaaatacagagcgccgaagaatatacc
caggtgttgaagaagctcatccggtcgcccaacatacctcatcagtattggctcacgctt
cagtatttgctaaaacacttcttcaggctctcgcaggcctccagcaagagtctcttaact
gcaagagcgctcgcagaaattttcagccctatgcttttcagattccctgcggccagccct
gataatactgagcacctcgttaaagttatagaaattttaatctgcaacgaatggagtgat
cgacaacctgcaccagcactgccccccaaaccaccaaaacccactactgtcgccaacaac
gggacgaacaacaacatgtccctgcaggacgcagaatggtactggggggacatctcaagg
gaagaggtgaacgagaaacttcgagatacggcagatgggaccttcttggtacgagacgca
tctactaagatgcatggtgattatactctcacactaaggaaaggaggaaataacaaatta
atcaaaatatttcaccgagatgggaaatatggcttctctgacccattaaccttcaactct
gtggttgaactaataaaccactaccggaatgaatccctagcgcagtataatcccaaactg
gatgtgaagttgctttatccagtgtccaaataccaacaggatcaggttgttaaagaagat
aatattgaagctgtagggaaaaagttacatgaatataacactcaatttcaagagaaaagc
cgggaatatgatagattatatgaagagtatacccgtacttcccaggaaatccaaatgaaa
agaacagctattgaagcatttaatgaaaccataaaaatatttgaagaacagtgccaaacc
caagagcggtacagcaaagaatacatagaaaagttcaaacgcgaaggcaatgagaaggaa
atacaaaggattatgcacaattatgataagttaaagtctcgaatcagcgagattatcgac
agcaggagacgcctggaggaggacttgaagaagcaggcggccgagtaccgggagatcgac
aaacgcatgaacagcatcaaaccagacctcatccagctgagaaagacgagagaccaatac
ttgatgtggctgacgcagaaaggtgtccggcagaagaagctgaacgagtggcttggcaac
gagaacacggaagaccaatactcgctggtggaggacgacgaggacctgccccaccacgac
gagaagacgtggaacgtcggcagcagcaaccgcaacaaagccgaaaccctgctgcgcggg
aagcgggacggcacctttctggtccgggagagcagcaaacagggctgctacgcctgctcc
gtggtggtggacggcgaggtcaagcactgtgtcatcaacaagacggccaccggctacggc
ttcgccgagccctataacctgtacagctccctgaaagaactggtgctacattaccaacac
acctcgctcgtgcagcacaacgactctctcaacgtcacactagcctacccggtctatgca
cagcagaggcgatga

DBGET integrated database retrieval system