KEGG   Oryctolagus cuniculus (rabbit): 100337870
Entry
100337870         CDS       T03373                                 

Gene name
TMPRSS2
Definition
(RefSeq) transmembrane protease, serine 2
  KO
K09633  transmembrane protease serine 2 [EC:3.4.21.-]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu05164  Influenza A
ocu05202  Transcriptional misregulation in cancer
ocu05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    100337870 (TMPRSS2)
  09162 Cancer: specific types
   05215 Prostate cancer
    100337870 (TMPRSS2)
  09172 Infectious disease: viral
   05164 Influenza A
    100337870 (TMPRSS2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ocu01002]
    100337870 (TMPRSS2)
Enzymes [BR:ocu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     100337870 (TMPRSS2)
Peptidases and inhibitors [BR:ocu01002]
 Serine peptidases
  Family S1: chymotrypsin family
   100337870 (TMPRSS2)
SSDB
Motif
Pfam: Trypsin SRCR_2 Hepsin-SRCR DUF1986 SRCR Trypsin_2 Ldl_recept_a
Other DBs
NCBI-GeneID: 100337870
NCBI-ProteinID: XP_008250697
Ensembl: ENSOCUG00000024741
LinkDB
Position
Un
AA seq 511 aa
MASEGHLERPAYLPLPDAADKSRMALNSGLSPGVGPYYENHGYQPENLYARQPPVAPHVY
TVYPAQYYPSPVPQYTPRVVTQAATPAVRRQPRSGSGTSCTPKAKKALCITFALGAVLVG
AGLVIGLLWNFLEGRCSGMECGPSRICIRTSQWCDGVLHCPNGEDENRCVRLYGPNFILQ
VYSSQRKSWHPVCQDDWNESYGRAACKDMGYQSFYTSSGIADNSGATSFMKLNLSASNHD
LYQKLYHSDTCSSKAVVSLRCIECGVTSPGRQGRIVGGSHAAPGEWPWQVSLHVQGIHVC
GGSIITPQWIVTAAHCLEEPLNSARYWMAFAGILSQFSMLYPSGYQAEKVISHPNYDSKT
KNNDIALIKLQTPLTFNDRVRPVCLPNPGLMLEPEQPCWISGWGATYEKGKTSDLLNAAM
VPLIESWKCNSKYVYNNLITPSMICAGYLQGTIDSCQGDSGGPLVTLKNDIWWLIGDTSW
GSGCAKVNRPGVYGNVTAFTDWIYQQMRAHS
NT seq 1536 nt   +upstreamnt  +downstreamnt
atggcctctgaaggtcatcttgaacggccagcatacctccccttgcctgatgctgctgat
aagagcaggatggctttaaactcagggttatccccgggtgtcggaccctactacgaaaac
catggctaccaaccagaaaacctctacgcccgccagccccctgtggctccccatgtctac
acagtgtatccggcgcagtactatccgtccccggtcccacagtacaccccgagggtcgtg
acgcaggccgccacgcccgctgtgcgcaggcagccccgctccgggtcgggcacaagctgc
accccgaaggctaagaaggcgctgtgcatcacctttgccctgggcgccgtcctcgtcggg
gccgggctggtcatcggcctcctctggaacttcctggagggcaggtgctcagggatggag
tgtggcccctcgaggatctgcatccgcacctcccagtggtgtgacggggtcctacactgt
cccaacggagaggacgagaaccgctgcgttcgcctctacggaccaaacttcatcctccag
gtgtattcctcgcagaggaagtcctggcaccccgtgtgccaagacgactggaacgagagc
tacgggcgggcggcgtgcaaggacatgggctaccagagtttttatactagctccggaata
gcagacaacagcggggctaccagcttcatgaaactgaacctcagtgccagcaaccacgac
ctgtaccaaaagctctaccacagcgacacctgctcctccaaggctgtggtgtccctgcgc
tgcatcgagtgcggcgtgacctcgcccggcaggcagggcaggatcgtgggcggctcgcac
gccgcccccggagaatggccctggcaggtgagcctgcacgtgcagggcatccacgtgtgc
ggaggctccatcatcaccccccagtggatcgtgacggccgcccactgcctggaagagcct
ctgaacagcgcccgctactggatggcgtttgccgggattctgtcccagttctccatgctc
tacccaagcggataccaagctgagaaagtgatttctcaccccaactacgactccaagacc
aagaacaacgacatcgctctcatcaagttgcagacgcccctgacgttcaatgacagagtc
cgccccgtgtgtctgcccaacccaggcctgatgctggagccggagcagccctgctggatt
tccgggtggggggctacctacgagaaggggaagacgtcggacctgctgaacgccgccatg
gtgcccctgatcgagtcctggaaatgcaacagtaaatacgtctacaataacctgatcaca
ccctccatgatctgtgccggctacctgcaggggaccatcgactcctgccagggcgacagc
ggcgggcctctggtcactctgaagaatgacatctggtggctgatcggggacacgagctgg
gggtctggctgtgccaaagttaacagacccggggtgtacggcaacgtgacggcgttcaca
gactggatctaccagcagatgagggcacacagctaa

KEGG   Oryctolagus cuniculus (rabbit): 100355162
Entry
100355162         CDS       T03373                                 

Gene name
TMPRSS4
Definition
(RefSeq) transmembrane protease, serine 4
  KO
K09635  transmembrane protease serine 4 [EC:3.4.21.-]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu05164  Influenza A
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    100355162 (TMPRSS4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ocu01002]
    100355162 (TMPRSS4)
Enzymes [BR:ocu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     100355162 (TMPRSS4)
Peptidases and inhibitors [BR:ocu01002]
 Serine peptidases
  Family S1: chymotrypsin family
   100355162 (TMPRSS4)
SSDB
Motif
Pfam: Trypsin SRCR_2 Hepsin-SRCR Trypsin_2 DUF1986 SRCR Ldl_recept_a DUF397
Other DBs
NCBI-GeneID: 100355162
NCBI-ProteinID: XP_008247645
Ensembl: ENSOCUG00000016983
UniProt: G1TCR7
LinkDB
Position
Un
AA seq 437 aa
MDPASDQPLNGIDAAPLRKPRTSLENFKRVGVPIIAALLSLATIIILAVLIKVILDKYYF
LCGHPLRFIPLGQVCDGQANCAMGEDEEQCVKVFPERPSVAVRLSKDRSSLQVLNLATGN
WASVCFDSFSPALAKAACGKMGYSRTSNPTFRAVKIGPDQQLDVVEITQNNQELQVQNSS
RPCLSGSLVSLTCLACGQSPKAPRVVGGQQASVDSWPWQVSIQYKKQHVCGGSILDPHWI
LTAAHCFRKHLDVYSWKVRAGSEKVDDSPSLPVAKIFVSEYNSSYPKEKDIALVKLQFPL
TFSDTVRPICLPFFDEELPPATPLWVVGWGFTEEGGGKMSDTLLQASVQVIDHTRCNAED
AYQGEVTETMLCAGIPGGGVDTCQGDSGGPLMYHAGQWQVVGIVSWGHGCGGPSTPGVYT
KVAAYLDWIYNVRKSEL
NT seq 1314 nt   +upstreamnt  +downstreamnt
atggatcccgccagtgaccaacccctgaacggcatcgatgctgctcccctgcgcaagccc
cgcacctcactggagaacttcaaaagggtgggggtccccatcatcgcggcactgctgagc
ctggcaaccatcatcattctggctgtcctcatcaaggtgattctggataaatactacttc
ctctgcgggcaccccctgcgcttcatccccttgggacaggtgtgtgacggccaggcaaac
tgtgccatgggagaggacgaggagcagtgtgtcaaggtcttccctgagcgaccctctgtg
gcagtccgcctctccaaggaccgatccagcctgcaggtgctgaacctggccacggggaac
tgggcctctgtctgcttcgacagcttctcaccagccctggcaaaggcagcctgcgggaag
atgggctacagcaggaccagcaaccccacgttcagagctgtgaagattggcccagaccaa
cagctggatgtcgttgaaatcacacaaaacaaccaggagctgcaggtgcagaactcaagc
aggccctgtctctcaggctccctggtctccctgacctgccttgcctgtgggcagagcccc
aaggcccctcgcgtggtgggcgggcagcaggcctctgtggattcctggccttggcaggtc
agcatccagtacaagaagcagcacgtctgcggagggagcatcctggacccccactggatc
ctcacggcagcccattgcttcaggaagcacctcgacgtgtacagctggaaggtgcgggct
ggctcagagaaagtggacgactccccgtccctgcctgtggctaagatcttcgtctccgag
tacaacagctcgtaccccaaggagaaggacatcgccctggtgaagctgcagttcccgctc
accttctcagacacagtcaggcccatctgcctgcccttcttcgatgaggagctccctcca
gccaccccgctctgggtcgtgggctggggctttacagaagagggtggagggaagatgtcc
gacacgttgctgcaggcgtccgtccaggtcattgaccacacacggtgcaatgcagaggat
gcataccagggtgaagtcaccgagacaatgctgtgtgcaggcatcccgggaggtggtgtg
gacacttgccagggcgacagcggtgggcccctgatgtaccatgctggccagtggcaggtg
gtgggcatcgtgagctggggccatggctgcgggggcccaagcaccccaggagtgtacacc
aaggtcgccgcctatctcgactggatctacaatgtcaggaagtctgagctgtga

DBGET integrated database retrieval system