KEGG   Oryctolagus cuniculus (rabbit): 100338989
Entry
100338989         CDS       T03373                                 

Gene name
CCNB1
Definition
(RefSeq) cyclin B1
  KO
K05868  G2/mitotic-specific cyclin-B1
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04068  FoxO signaling pathway
ocu04110  Cell cycle
ocu04114  Oocyte meiosis
ocu04115  p53 signaling pathway
ocu04218  Cellular senescence
ocu04914  Progesterone-mediated oocyte maturation
ocu05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100338989 (CCNB1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100338989 (CCNB1)
   04114 Oocyte meiosis
    100338989 (CCNB1)
   04115 p53 signaling pathway
    100338989 (CCNB1)
   04218 Cellular senescence
    100338989 (CCNB1)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100338989 (CCNB1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100338989 (CCNB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ocu03032]
    100338989 (CCNB1)
   03036 Chromosome and associated proteins [BR:ocu03036]
    100338989 (CCNB1)
DNA replication proteins [BR:ocu03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Prevention of re-replication factors
    100338989 (CCNB1)
Chromosome and associated proteins [BR:ocu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    100338989 (CCNB1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C Trypan_PARP
Other DBs
NCBI-GeneID: 100338989
NCBI-ProteinID: XP_008260527
Ensembl: ENSOCUG00000004340
LinkDB
Position
11
AA seq 483 aa
MRRSGAGFKPEQGPAPPGVLRRNGRLLACGGFWSETGRGLRCAACARRPPPVEEEAMALR
VTRNTKINVENKGKMTMAGAKRVPVATAAACKPGLRPRTALGDIGNKVSEQLQAKVPLKK
EAKTLPTGKIPAKKLPKPLETVTVPASEPEPEPEPEAEPVKEEKLSPEPILVDTPSPSPM
ETSACAPAEEYLCQAFSDVILAVSDVDAEDGADPNLCSEYVKDIYAYLRQLEEEQSVRPK
YLLGREVTGNMRAILIDWLVQVQMKFRLLQETMYMTVSIIDRFMQDNCVPKKMLQLVGVT
AMFIASKYEEMYPPEIGDFAFVTNNTYTKHQIRQMEMKILRVLNFGLGRPLPLHFLRRAS
KIGEVDVEQHTLAKYLMELTMLDYDMVHFPPSQIAAGAFCLALKILDNGEWTPTLQHYLS
YTEEALLPVMQHLAKNVVMVNRGLTKHMTIKNKYATSKHAKISTLAQLNSALVQDLAKAV
AKV
NT seq 1452 nt   +upstreamnt  +downstreamnt
atgaggaggagcggagcggggtttaaacctgagcaggggccggcgcctcccggcgtgctg
cgcaggaacggccggctgttggcttgtggaggcttctggtccgagacgggtcggggcctc
cggtgtgctgcgtgtgcccgccgcccgccgcctgtcgaggaggaagccatggcgctccgc
gtcaccaggaacacgaaaattaacgtggaaaacaaggggaagatgaccatggcaggcgcc
aagcgtgtgcctgtggccacggctgcagcctgcaagcccgggctgaggcccagaacggcc
ctgggagacattggtaacaaagtcagcgagcagctccaggccaaagtgcctctgaagaag
gaagccaaaactctacctactgggaaaatccctgctaaaaaactccctaaacctttggaa
acggtgactgtaccggcatctgagccggagccggagcccgagcccgaagctgagcctgtt
aaagaagaaaaactctcgcctgagccgattctggttgatactccctccccaagcccgatg
gagacgtccgcatgtgcgcctgcagaggagtatctgtgtcaggcgttctcggacgtgatt
cttgcagtgagtgatgtggacgcagaggatggggctgatccaaacctttgtagcgagtat
gtgaaggatatctatgcatacctgcgacagcttgaggaagagcaatcagtcagaccgaaa
tacctcctgggtcgggaagtcactggaaacatgagggccatcctaatcgactggctagtc
caggttcagatgaagttcaggctgctgcaggagaccatgtacatgactgtttccataatt
gatcggttcatgcaggacaattgtgtgcccaagaagatgctgcagctggttggtgtcact
gccatgtttattgcaagcaaatatgaagaaatgtaccctccagaaattggtgactttgct
tttgtgactaacaacacctacactaagcaccaaatcagacagatggaaatgaagattctc
agagttttaaactttggcctgggtcgccctctccccttacacttccttcggagagcatct
aagatcggagaggttgatgttgagcagcatactttggccaaatacctgatggaactgact
atgctggactatgacatggtgcactttcctccttctcagattgcagcaggagccttttgc
ttagcactgaaaattcttgataatggtgaatggacgccaaccctacagcattacctgtca
tacaccgaggaagctctccttcctgtcatgcagcacctggctaagaatgtagtgatggtg
aatcgtgggcttacaaagcacatgaccatcaagaacaagtatgccacatctaagcatgct
aagatcagcactctagcccagctgaattctgcactggttcaagacttagccaaggctgtg
gccaaggtgtaa

KEGG   Oryctolagus cuniculus (rabbit): 100357416
Entry
100357416         CDS       T03373                                 

Gene name
CCNB2
Definition
(RefSeq) cyclin B2
  KO
K21770  G2/mitotic-specific cyclin-B2
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04068  FoxO signaling pathway
ocu04110  Cell cycle
ocu04114  Oocyte meiosis
ocu04115  p53 signaling pathway
ocu04218  Cellular senescence
ocu04914  Progesterone-mediated oocyte maturation
ocu05166  Human T-cell leukemia virus 1 infection
ocu05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100357416 (CCNB2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100357416 (CCNB2)
   04114 Oocyte meiosis
    100357416 (CCNB2)
   04115 p53 signaling pathway
    100357416 (CCNB2)
   04218 Cellular senescence
    100357416 (CCNB2)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100357416 (CCNB2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100357416 (CCNB2)
   05170 Human immunodeficiency virus 1 infection
    100357416 (CCNB2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ocu03032]
    100357416 (CCNB2)
   03036 Chromosome and associated proteins [BR:ocu03036]
    100357416 (CCNB2)
DNA replication proteins [BR:ocu03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Prevention of re-replication factors
    100357416 (CCNB2)
Chromosome and associated proteins [BR:ocu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    100357416 (CCNB2)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C DUF5806
Other DBs
NCBI-GeneID: 100357416
NCBI-ProteinID: XP_002718251
Ensembl: ENSOCUG00000001652
UniProt: G1SFU5
LinkDB
Position
17
AA seq 398 aa
MALLRRPTVSSDLENIDTGINAKAKSHVTVRRAVLEEIGNRVTTRAVQIAKKAQNTKIPV
QHTKATNVSKQLKPTASVKPVQMEMLAPKGPSPVPEDVSMKEENLCQAFSDALLCKIEDI
DNEDWENPQLCSDYVKDIYQYLRQLEVLQSINPHFLDGRDINGRMRAILVDWLVQVHSKF
RLLQETLYMCVAIMDRFLQVQPVSRKKLQLVGITALLLASKYEEMFSPNIEDFVYITDNA
YTSSQIREMETLILKELKFELGRPLPLHFLRRASKAGEVDVEQHTLAKYLMELTLIDYDM
VHYHPSKVAAAASCLSQKVLGQGKWNLKQQYYTGYTENEVLEVMQHMAKNVVKVNENLTK
FIAIKNKYASSKLLKISTIPQLNSKTIKDLASPLMRRA
NT seq 1197 nt   +upstreamnt  +downstreamnt
atggcgctgctccgacgcccgacggtgtccagtgatttggagaatatagatacaggaatt
aatgctaaagctaagagtcatgtgactgttaggcgtgctgttttagaagaaattggaaat
agagttacaaccagagcagtacaaatagctaagaaagctcagaacactaaaataccagtg
caacacaccaaagctacaaatgtcagcaaacaactgaaacctactgcttctgtgaaacca
gttcaaatggaaatgttggctccaaagggcccttcccctgtacctgaggatgtctccatg
aaggaagagaacctctgccaagctttctctgatgctttgctctgcaaaatcgaggatatt
gataatgaagactgggagaacccgcagctctgcagtgactatgttaaggatatttaccag
tatctaaggcagctggaggttttgcagtccataaacccacatttcttagatggaagagac
ataaatggacgtatgcgtgctatcctggtggactggctcgtgcaagtgcactccaagttc
aggctcctgcaggagaccctgtatatgtgcgtcgccatcatggataggtttttacaggtt
caaccagtctcccgcaagaagcttcaactcgttgggataactgctctgctattggcttcc
aagtacgaggagatgttttctccaaatattgaagacttcgtttatatcacagacaacgct
tataccagttctcaaatccgagaaatggaaactctaattttgaaagaactgaaatttgaa
ctgggtcgacccttgcccttacacttcttaagacgagcatcaaaagcaggcgaggttgat
gtggaacagcatactttagccaagtacttgatggagctgactctcattgactatgacatg
gtgcattatcacccttctaaggtagcggcggctgcttcctgcttgtctcagaaggttcta
ggccaaggaaaatggaatttaaagcagcagtattacacaggatacaccgagaacgaggtg
ctggaagtcatgcagcacatggccaaaaatgtggtgaaagtaaatgaaaacttaactaaa
ttcatcgccatcaagaataagtatgcaagcagcaaactcctgaagatcagcacgatccct
cagctgaactcaaaaaccatcaaggaccttgcctcccctctcatgagaagggcctag

DBGET integrated database retrieval system