KEGG   Oryctolagus cuniculus (rabbit): 100339517
Entry
100339517         CDS       T03373                                 

Gene name
PTPN11
Definition
(RefSeq) protein tyrosine phosphatase, non-receptor type 11
  KO
K07293  tyrosine-protein phosphatase non-receptor type 11 [EC:3.1.3.48]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04014  Ras signaling pathway
ocu04072  Phospholipase D signaling pathway
ocu04360  Axon guidance
ocu04625  C-type lectin receptor signaling pathway
ocu04630  JAK-STAT signaling pathway
ocu04650  Natural killer cell mediated cytotoxicity
ocu04670  Leukocyte transendothelial migration
ocu04722  Neurotrophin signaling pathway
ocu04920  Adipocytokine signaling pathway
ocu04931  Insulin resistance
ocu05168  Herpes simplex virus 1 infection
ocu05205  Proteoglycans in cancer
ocu05211  Renal cell carcinoma
ocu05220  Chronic myeloid leukemia
ocu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100339517 (PTPN11)
   04630 JAK-STAT signaling pathway
    100339517 (PTPN11)
   04072 Phospholipase D signaling pathway
    100339517 (PTPN11)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100339517 (PTPN11)
   04650 Natural killer cell mediated cytotoxicity
    100339517 (PTPN11)
   04670 Leukocyte transendothelial migration
    100339517 (PTPN11)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    100339517 (PTPN11)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100339517 (PTPN11)
  09158 Development and regeneration
   04360 Axon guidance
    100339517 (PTPN11)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100339517 (PTPN11)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100339517 (PTPN11)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    100339517 (PTPN11)
   05211 Renal cell carcinoma
    100339517 (PTPN11)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    100339517 (PTPN11)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    100339517 (PTPN11)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ocu01009]
    100339517 (PTPN11)
Enzymes [BR:ocu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     100339517 (PTPN11)
Protein phosphatases and associated proteins [BR:ocu01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Classical)
   Non-receptor PTPs
    100339517 (PTPN11)
SSDB
Motif
Pfam: Y_phosphatase SH2 DSPc Y_phosphatase3 PTPlike_phytase
Other DBs
NCBI-GeneID: 100339517
NCBI-ProteinID: XP_008270490
Ensembl: ENSOCUG00000004533
UniProt: G1SLZ8
LinkDB
Position
21
AA seq 597 aa
MTSRRWFHPNITGVEAENLLLTRGVDGSFLARPSKSNPGDFTLSVRRNGAVTHIKIQNTG
DYYDLYGGEKFATLAELVQYYMEHHGQLKEKNGDVIELKYPLNCADPTSERWFHGHLSGK
EAEKLLTEKGKHGSFLVRESQSHPGDFVLSVRTGDDKVESNDGKSKVTHVMIRCQELKYD
VGGGERFDSLTDLVEHYKKNPMVETLGTVLQLKQPLNTTRINAAEIESRVRELSKLAETT
DKVKQGFWEEFETLQQQECKLLYSRKEGQRQENKNKNRYKNILPFDHTRVVLHDGDPNEP
ASDYINANIIMPEFETKCNNSKPRKSYIATQGCLQNTVNDFWRMVFQENSRVIVMTTKEV
ERGKSKCVKYWPDEYALKEYGVMRVRNVKESAAHDYTLRELKLSKVGQALLQGNTERTVW
QYHFRTWPDHGVPSDPGGVLDFLEEVHHKQESIMDAGPVVVHCSAGIGRTGTFIVIDILI
DIIREKGVDCDIDVPKTIQMVRSQRSGMVQTEAQYRFIYMAVQHYIETLQRRIEEEQKSK
RKGHEYTNIKYSLAEQTSGDQSPLPPCTPAPPCAEMREDNARVYENVGLMQQQKSFR
NT seq 1794 nt   +upstreamnt  +downstreamnt
atgacatcgcggagatggtttcacccaaatatcactggtgtggaggcagaaaacctactg
ttgacaagaggagttgatggcagttttttggcaaggcccagtaaaagtaaccctggagac
ttcacactttccgtcagaagaaatggagctgtcacccacatcaagattcagaacactggt
gattattatgacctctatggaggggagaagtttgccactttggctgagctggttcagtat
tacatggaacaccatgggcagctgaaggagaagaatggagatgtgattgagctcaagtac
cctctgaactgtgcagatcctacctctgaacggtggtttcacgggcacctctctgggaaa
gaagcagagaaattattgactgagaaaggaaaacatggcagcttcctggtccgcgagagc
cagagccaccctggagattttgttctctccgtccgcactggcgacgacaaggtggagagc
aatgacggcaagtccaaggtgacccacgtcatgattcgctgtcaggaactgaaatacgat
gttggtggaggagagcggtttgattctctgacagatctggtggaacattacaagaaaaat
cctatggtagaaaccttgggcacagtgctgcaactcaagcagcccctcaatacaacccgt
ataaacgcagctgaaatagagagccgggttcgagaactgagcaaactggccgagaccaca
gataaagtcaagcaaggcttttgggaagaatttgagacactacaacaacaggagtgcaaa
cttctctacagccggaaggagggtcagaggcaagaaaataaaaacaaaaatagatataaa
aacatcctgccttttgaccacaccagggtcgtcctgcatgacggggatcccaacgagcct
gcttcggattacatcaacgcaaacatcatcatgcctgaatttgaaaccaagtgcaacaat
tcaaagcccaggaagagttacattgccacgcaaggatgcctgcagaacacggtgaacgac
ttctggcggatggtgttccaggagaactcccgtgtgatcgtcatgacaacaaaagaggtg
gaacggggaaagagtaaatgtgtcaaatactggcccgatgagtatgctctaaaagaatac
ggtgtcatgcgtgttaggaacgtcaaagaaagtgccgctcatgactataccttaagagaa
cttaaactttcgaaggtcggacaagctctactccaggggaatacggagagaacggtctgg
caataccactttcggacctggccggaccacggcgtgcccagcgaccccgggggcgtgctg
gacttcctggaggaggtccaccacaagcaggagagcatcatggacgccggcccggtcgtg
gttcactgcagtgctggaatcggccggacagggacgtttattgtgattgatatccttatt
gacatcatcagagaaaaaggtgttgactgtgacattgacgtgcccaagaccattcagatg
gtgcggtctcagaggtcagggatggtgcagacagaggcgcagtaccgctttatctacatg
gctgtccagcattacattgaaacactacagcgcaggatcgaggaggagcagaaaagcaag
aggaaagggcacgaatacacaaacatcaagtattccctcgccgagcagacaagcggggat
cagagccccctcccgccctgtacccccgcgcctccctgtgcggaaatgcgagaagataat
gctagagtctatgagaacgtgggcctgatgcagcagcagaaaagcttccgctga

DBGET integrated database retrieval system