KEGG   Oryctolagus cuniculus (rabbit): 100342142
Entry
100342142         CDS       T03373                                 

Gene name
RCHY1
Definition
(RefSeq) ring finger and CHY zinc finger domain containing 1
  KO
K10144  RING finger and CHY zinc finger domain-containing protein 1 [EC:2.3.2.27]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04115  p53 signaling pathway
ocu04120  Ubiquitin mediated proteolysis
ocu05162  Measles
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100342142 (RCHY1)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    100342142 (RCHY1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05162 Measles
    100342142 (RCHY1)
Enzymes [BR:ocu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     100342142 (RCHY1)
Ubiquitin system [BR:ocu04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    100342142 (RCHY1)
SSDB
Motif
Pfam: zinc_ribbon_6 zf-CHY zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_5 zf-RING_UBOX zf-C3HC4_3 Prok-RING_4 zf-RING_11 zf-rbx1
Other DBs
NCBI-GeneID: 100342142
NCBI-ProteinID: XP_002717057
Ensembl: ENSOCUG00000000365
LinkDB
Position
15
AA seq 261 aa
MAATAREDGARSRQRGQRGCEHYDRGCLLKAPCCDKLYTCRLCHDNNEDHQLDRFKVKEV
QCINCEKIQHAQQTCEECSTLFGEYYCNICHLFDKDKKQYHCENCGICRIGPKEDFFHCL
KCNLCLAMNLQGKHKCIENVSRQNCPICLEDIHTSRVVAHVLPCGHLLHRTCYEEMLKEG
YRCPLCMHSALDMTRYWRQLDDEVAQTPMPSEYQNMTVDILCNDCNGRSTVQFHILGMKC
KICDSYNTAQAGGRRISLDHQ
NT seq 786 nt   +upstreamnt  +downstreamnt
atggcggcgacggcgcgggaagatggcgcccgcagccggcagcgagggcagcggggctgc
gagcactatgacagaggatgtctcttgaaggcaccttgctgtgacaagctttatacttgc
cgcctgtgtcatgataacaatgaagatcatcaactagatcgatttaaagtaaaggaagtg
cagtgtataaactgtgaaaagattcaacatgcccagcagacttgtgaagagtgtagtaca
ttgtttggagaatattattgcaatatatgccacttgttcgacaaagataagaagcaatat
cattgtgaaaactgtggaatttgtaggattggcccaaaggaagattttttccactgtttg
aaatgtaatttatgcctagccatgaatcttcaaggaaaacataagtgtattgaaaatgtt
tcccggcagaattgcccaatatgcttggaggacattcacacgtcccgtgttgtggctcac
gtcttgccatgtggacatctcttacatagaacgtgttatgaagaaatgttgaaagaaggc
taccgatgcccattgtgtatgcactctgctttagatatgaccaggtactggaggcagctg
gatgatgaggtggcacagactccaatgccctccgagtatcagaacatgactgtggatatt
ctctgcaatgactgtaatggacgatccacagtccagttccatattttaggcatgaaatgt
aagatttgtgactcctacaatactgctcaagctggaggacgtagaatttcactggatcac
cagtga

DBGET integrated database retrieval system