KEGG   Oryctolagus cuniculus (rabbit): 100345640
Entry
100345640         CDS       T03373                                 

Gene name
ICAM1
Definition
(RefSeq) intercellular adhesion molecule 1
  KO
K06490  intercellular adhesion molecule 1
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04064  NF-kappa B signaling pathway
ocu04514  Cell adhesion molecules
ocu04650  Natural killer cell mediated cytotoxicity
ocu04668  TNF signaling pathway
ocu04670  Leukocyte transendothelial migration
ocu04933  AGE-RAGE signaling pathway in diabetic complications
ocu05143  African trypanosomiasis
ocu05144  Malaria
ocu05150  Staphylococcus aureus infection
ocu05164  Influenza A
ocu05166  Human T-cell leukemia virus 1 infection
ocu05167  Kaposi sarcoma-associated herpesvirus infection
ocu05169  Epstein-Barr virus infection
ocu05323  Rheumatoid arthritis
ocu05416  Viral myocarditis
ocu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100345640 (ICAM1)
   04668 TNF signaling pathway
    100345640 (ICAM1)
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100345640 (ICAM1)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100345640 (ICAM1)
   04670 Leukocyte transendothelial migration
    100345640 (ICAM1)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    100345640 (ICAM1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100345640 (ICAM1)
   05416 Viral myocarditis
    100345640 (ICAM1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100345640 (ICAM1)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    100345640 (ICAM1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100345640 (ICAM1)
   05164 Influenza A
    100345640 (ICAM1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100345640 (ICAM1)
   05169 Epstein-Barr virus infection
    100345640 (ICAM1)
  09174 Infectious disease: parasitic
   05144 Malaria
    100345640 (ICAM1)
   05143 African trypanosomiasis
    100345640 (ICAM1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ocu04147]
    100345640 (ICAM1)
   04090 CD molecules [BR:ocu04090]
    100345640 (ICAM1)
   00536 Glycosaminoglycan binding proteins [BR:ocu00536]
    100345640 (ICAM1)
   04091 Lectins [BR:ocu04091]
    100345640 (ICAM1)
Exosome [BR:ocu04147]
 Exosomal proteins
  Proteins found in most exosomes
   100345640 (ICAM1)
CD molecules [BR:ocu04090]
 Proteins
  100345640 (ICAM1)
Glycosaminoglycan binding proteins [BR:ocu00536]
 Hyaluronan
  Cell surface receptors
   100345640 (ICAM1)
Lectins [BR:ocu04091]
 I-type lectins (Siglecs)
  100345640 (ICAM1)
SSDB
Motif
Pfam: ICAM_N Ig_2 Ig_3 ig C2-set_2
Other DBs
NCBI-GeneID: 100345640
NCBI-ProteinID: XP_008248965
Ensembl: ENSOCUG00000029644
LinkDB
Position
Un
AA seq 591 aa
MPEPLFRRGRLKVSGKAPPPPPGPPWPAAIRGPARRSPPQCAPCAPAPRCSARVLPAMAP
DRVRRALPALLALLAALLPGPGDAQTSVFPSEVTLPRGGSTRVNCSAACAEPSKLGLETQ
LSKEEVAHGDNWKVFELSDVQEDSTLICFSDCESQSMASARLTVYATPDSVELAPLPPWQ
PVGEDLTLRCRVVGGQPRAQLSVLLLRGEEELSRQPALGEPAEVTATVQADRSDHGANFS
CVTELDLRPLGLELFKNVSAPRQLQTFELPVTGPQLAATPAVVEVGAQCHVSCSLDGLFP
APEAQVQLELGGRKLDATVSHGKDAVSAMASVRGTAEEEGAQQVVCAVLLGNRRVEATAE
VTVYSFPAPNLTLSEPEVSEGTEVVVQCEGHDGTRVTLDGTPAWPVSARAQLRLNASAED
NGRRFSCSAALDVAGQVLRKNQTRELRVLYGPRLDERDCLGNWTWQEGSQQTLRCEAWGN
PRPELSCRREGTGAPLPIGELRPVQRQFAGTYLCRAVSSRGEVTREVFIHVLPYKHSNVV
IIIVVAAVVLLGTWGTAAYVYNRQRKIKKYKLQKAQEAATVKLNTPQASPS
NT seq 1776 nt   +upstreamnt  +downstreamnt
atgcctgagcccttgttccggaggggaaggctcaaggtttccgggaaagccccgcccccc
cccccaggccccccgtggccggcggctataagaggacccgcgcgccgctcgccgccccag
tgcgcaccctgcgccccggctccgcgctgctccgcccgcgtcctgcccgctatggctccc
gaccgcgtccggcgcgcgctgcccgcgctcctggccctgctcgcggctctgctgccaggc
cccggggacgcgcagacgtcggtgttcccctcggaagtcacgctgccccgtggcggctcc
acgcgggtcaactgcagcgccgcctgcgccgagccgtcgaagctcggcctggagacgcag
ctgagcaaggaggaggtggcccacggggacaactggaaggtgttcgagctgagtgacgtg
caggaagacagtaccctcatctgcttttccgactgtgagagccagtccatggcctctgcc
aggctcacggtgtacgcaaccccggacagcgtggagctggcgcccctgcccccctggcag
cccgtcggggaggacctcaccctgcgctgccgggtggtgggcgggcagccccgggcccag
ctctcggtgctgctgctccgcggggaggaggagctgagccggcagccggcgctgggggag
cccgcggaggtcacggccacggtgcaggccgacagaagcgaccacggcgccaatttctcc
tgcgtcaccgaactggacctgcggcccctgggcttggagttgttcaagaacgtctcggcc
cccaggcagctgcaaacgttcgagctgccggtgactgggccacagctggccgccaccccc
gcagtcgtggaggtgggcgctcagtgccacgtgtcctgctccctggatgggctcttccct
gccccggaggcgcaggtccagctggaactggggggccggaagctggacgccaccgtcagt
cacggcaaggacgcggtcagcgccatggcctccgtgcgtgggacagcggaggaggaaggt
gcccagcaggtggtgtgtgcggtgctactggggaaccggcgggtggaggcgacggccgaa
gtgactgtgtacagcttcccagctcccaacctgaccttgagcgagccagaggtctccgaa
ggcaccgaggtggttgtgcagtgtgagggccacgacggaaccagggtgacgctggacggt
accccagcctggccggtgtccgcgcgggcccagctgcggctgaacgccagcgccgaggac
aacgggcgccgcttctcctgctctgccgccctggacgtggccgggcaggtgctacgcaaa
aaccagacccgggagctgcgtgtgttgtatggcccgagactggacgagagggactgcctg
ggaaactggacttggcaggagggcagccagcagactctgagatgcgaggcctgggggaac
ccgcgcccggagctcagctgccgccgcgagggaaccggggctccgctgcccatcggcgag
cttaggcccgtccagcgccagttcgcggggacctacctctgccgggccgtgagttctcgc
ggggaggtcacccgcgaggtcttcatccacgtgctgccctacaagcacagtaacgtggtg
atcatcatcgtggtggcggccgtggtcctcctgggcacctggggcaccgctgcctacgtc
tacaaccgtcagaggaagatcaaaaagtacaagctgcagaaggcacaggaggcggccacc
gtgaagctgaacacgccgcaagcctcgccgtcctga

DBGET integrated database retrieval system