KEGG   Oryctolagus cuniculus (rabbit): 100347455
Entry
100347455         CDS       T03373                                 

Gene name
PTK2
Definition
(RefSeq) protein tyrosine kinase 2
  KO
K05725  focal adhesion kinase 1 [EC:2.7.10.2]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu01522  Endocrine resistance
ocu04012  ErbB signaling pathway
ocu04062  Chemokine signaling pathway
ocu04151  PI3K-Akt signaling pathway
ocu04360  Axon guidance
ocu04370  VEGF signaling pathway
ocu04510  Focal adhesion
ocu04670  Leukocyte transendothelial migration
ocu04810  Regulation of actin cytoskeleton
ocu04935  Growth hormone synthesis, secretion and action
ocu05100  Bacterial invasion of epithelial cells
ocu05135  Yersinia infection
ocu05146  Amoebiasis
ocu05163  Human cytomegalovirus infection
ocu05165  Human papillomavirus infection
ocu05170  Human immunodeficiency virus 1 infection
ocu05200  Pathways in cancer
ocu05202  Transcriptional misregulation in cancer
ocu05205  Proteoglycans in cancer
ocu05222  Small cell lung cancer
ocu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100347455 (PTK2)
   04370 VEGF signaling pathway
    100347455 (PTK2)
   04151 PI3K-Akt signaling pathway
    100347455 (PTK2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100347455 (PTK2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100347455 (PTK2)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    100347455 (PTK2)
   04062 Chemokine signaling pathway
    100347455 (PTK2)
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    100347455 (PTK2)
  09158 Development and regeneration
   04360 Axon guidance
    100347455 (PTK2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100347455 (PTK2)
   05202 Transcriptional misregulation in cancer
    100347455 (PTK2)
   05205 Proteoglycans in cancer
    100347455 (PTK2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100347455 (PTK2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100347455 (PTK2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100347455 (PTK2)
   05100 Bacterial invasion of epithelial cells
    100347455 (PTK2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100347455 (PTK2)
   05163 Human cytomegalovirus infection
    100347455 (PTK2)
   05165 Human papillomavirus infection
    100347455 (PTK2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100347455 (PTK2)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100347455 (PTK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ocu01001]
    100347455 (PTK2)
   01009 Protein phosphatases and associated proteins [BR:ocu01009]
    100347455 (PTK2)
Enzymes [BR:ocu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     100347455 (PTK2)
Protein kinases [BR:ocu01001]
 Non-receptor tyrosine kinases
  FAK family
   100347455 (PTK2)
Protein phosphatases and associated proteins [BR:ocu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100347455 (PTK2)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Focal_AT Pkinase FERM_N_2 FERM_M Kinase-like FERM_F2
Other DBs
NCBI-GeneID: 100347455
NCBI-ProteinID: XP_017195003
Ensembl: ENSOCUG00000003282
LinkDB
Position
Un
AA seq 1096 aa
MAAAYLDPNLNHTANPSAKTHLGPGMERSPGAMERVLKVFHYFESNSEPTTWASIIRHGD
ATDVRGIIQKIVDSHKVKHVACYGFRLSHLRSEEVHWLHVDMGVSSVREKYELAHPPEEW
KYELRIRYLPKGFLNQFTEDKPTLNFFYQQVKSDYMLEIADQVDQDIALKLGCLEIRRSY
WEMRGNALEKKSNYEVLEKDVGLKRFFPKSLLDSVKAKTLRKLIQQTFRQFANLNREESI
LKFFEILSPVYRFDKECFKCALGSSWIISVELAIGPEEGISYLTDKGCNPTHLADFNQVQ
TIQYSNSEDKDRKGMLQLKIAGAPEPLTVTAPSLTIAENMADLIDGYCRLVNGATQSFII
RPQKEGERALPSIPKLANSEKQGVRTHAVSMSGVSHCQHKVKKARRFLPLIFCSHEPPPP
DEISGDETDDYAEIIDEEDTYTMPSKSYGIDKARDYEIQRDRIELGRCIGEGQFGDVHQG
VYMSPENPALAVAIKTCKNCTSDSVREKFLQEALTMRQFDHPHIVKLVGVITENPVWIIM
ELCTLGELRSFLQVRKFSLDLASLILYAYQLSTALAYLESKRFVHRDIAARNVLVSSNDC
VKLGDFGLSRYMEDSTYYKASKGKLPIKWMAPESINFRRFTSASDVWMFGVCVWEILMHG
VKPFQGVKNNDVIGRIENGERLPMPPNCPPTLYSLMTKCWAYDPSRRPRFTELKAQLSTV
LEEEKAQQEERMRMESRRQATVSWDSGGADEAPPKPSRPGYPSPRSSEGFYPSPQHLVQT
NHYQGSGYPGSHGVTAMAGSGYPSQASLLDQTDSWNPRAQEMPMWQPSVEDSAALDLRGM
GQVLPAHLMEERLIRQQQEMEEDQRWLEKEERFLKPDVRLSRGSIDREDGGLQGPTGNQH
IYQPVGKPDPAAPPKKPPRPGAPGHLGSLASLSSPGDSYNEGVKPWRLQPQEISPPPTAN
LDRSNDKVYENVTGLVKAVIEMSSRIQPAPPEEYVPMVKEVGLALRTLLATVDETIPVLP
TSTHREIEMAQKLLNSDLGELISKMKLAQQYVMTSLQQEYKKQMLTAAHALAVDAKNLLD
VIDQARLRVLGQTRPH
NT seq 3291 nt   +upstreamnt  +downstreamnt
atggcagctgcttacctcgacccgaacttgaatcacacagcgaatcccagtgccaagact
cacctgggtcctggcatggagcgctcccctggtgccatggagcgagtgttgaaagtcttt
cattactttgaaagcaatagtgagccaaccacctgggccagtattatcaggcatggagat
gcgactgatgtcaggggcatcattcagaagatagtggacagtcacaaggtaaagcacgtg
gcctgctatggattccgcctcagtcacctgcggtccgaggaggttcactggctccacgtg
gacatgggcgtctccagcgtgagggagaagtatgagctcgcccaccccccagaggagtgg
aaatacgaattgagaattcgttatttgcccaaaggatttctcaatcagtttactgaagac
aaaccaaccttgaatttcttctatcaacaggtgaagagtgactatatgttagagatagct
gatcaagtggaccaagacattgctttgaagctgggttgtctggaaatacggcgatcgtac
tgggagatgaggggcaatgccctagaaaagaagtcgaattatgaagtcttagaaaaagat
gttggtttaaagcgatttttccctaagagtttgctggattctgtcaaggccaaaacactc
agaaagctgatccagcagacgtttagacagtttgccaaccttaaccgagaagaaagtatt
ctcaaattcttcgagatcctctctccagtgtacagattcgataaggagtgcttcaagtgc
gcgctcgggtcaagctggattatttcagtggagctggcaattggcccagaagaagggatc
agctacctgacggacaagggctgcaaccccacacatctggctgacttcaatcaagtgcag
accattcagtattcaaacagcgaggacaaggacagaaaaggaatgctgcagctcaaaata
gccggcgcacccgagcctctcacagtgacggcaccctccctaaccatcgcagagaatatg
gctgacctgatagatggatactgccggctggtgaacggggccacacagtcctttatcatc
agaccccagaaagaaggtgaacgagctttgccatcaataccaaagttggccaacagtgag
aagcaaggcgtgaggacgcacgcagtctccatgtcaggagtcagtcactgccagcataaa
gttaagaaagccaggcgctttctccctttgatcttctgttcccatgagcctcctcctccg
gatgaaattagtggggacgagactgacgactatgctgagatcatagatgaagaagacacg
tacaccatgccctcaaaaagctatggaatagataaagccagggattatgaaattcaaaga
gaccgaatagaacttggacggtgtattggagaaggccagtttggagatgtacatcaagga
gtatacatgagtccagagaatccagctttggcggttgcaattaaaacttgcaaaaactgc
acctcggacagcgtgagagagaaatttcttcaagaagccttgaccatgcggcagttcgac
catcctcacatcgtgaagctcgttggagtcatcacggagaatcccgtctggataatcatg
gagctgtgcacgctgggagagctgcggtcatttctgcaagtcaggaaattcagtctggat
ctggcatccttgatcctgtatgcttatcagcttagcacagctcttgcgtatcttgagagc
aaaaggtttgtacacagggacattgctgctcggaatgttctagtgtcctcaaacgactgt
gtgaaattaggagacttcggactgtcgcgatatatggaagacagtacttactacaaagct
tccaaaggaaaattgcctattaagtggatggctccagagtccatcaattttcgacgtttt
acctcagctagtgacgtgtggatgtttggtgtatgtgtgtgggagatactgatgcatggt
gtgaagccttttcaaggagtgaagaacaatgatgtgatcggtcgcattgaaaatggggaa
agattaccaatgcctccaaattgtcctcccaccctctacagccttatgacgaaatgctgg
gcctatgaccccagcaggcggcccaggttcactgagcttaaagctcagctcagcacagtc
ctggaggaggagaaggctcagcaagaagaacgcatgaggatggagtccagaagacaggcc
acggtgtcctgggactctggaggggctgacgaagcaccacccaagcccagcagacccggc
taccccagtccaaggtccagtgaaggattttaccccagcccgcagcacttggtccagacc
aaccactaccagggctctggctaccctggctcacatggagtcacagccatggctggcagc
ggctacccaagtcaagcatctcttttggaccaaacagactcatggaatcccagagcccag
gagatgcccatgtggcagcccagcgtggaggactctgcagccctggatctccgggggatg
gggcaggtgctgccagcccacctgatggaggagcggctgatccgacagcaacaggaaatg
gaagaagatcagcgctggctggagaaagaagagagatttttgaaacccgacgtgaggctc
tctcgcggcagcattgaccgggaggacggcggtctccagggcccgactggaaaccaacac
atatatcagcccgtgggtaaaccagatcctgcagctccaccaaagaaaccgccacgcccc
ggagcccctggtcacctgggcagccttgccagcctcagcagccctggggacagttacaac
gagggcgttaagccgtggaggcttcagccccaggagatcagcccccctcctactgccaac
ctggaccggtccaacgacaaggtgtacgagaacgtgacaggcctggtgaaggctgtcatc
gagatgtccagcaggatccagccggccccgccggaggagtacgtgcccatggtgaaggaa
gtcggcctggccctgaggacattgttggccactgtggatgagaccatccctgtcctcccg
accagcacacaccgagagatcgagatggcgcagaagctgctgaactctgacctgggcgag
ctcatcagcaagatgaagctggcccagcagtacgtcatgaccagcctccagcaggagtac
aagaagcagatgctgacggctgcccacgccctggcagtggacgccaagaacctgctcgac
gtcatcgaccaagcaagactgcgagtgctcgggcagacgaggccgcactga

DBGET integrated database retrieval system