KEGG   Oryctolagus cuniculus (rabbit): 100347954
Entry
100347954         CDS       T03373                                 

Gene name
PDPK1
Definition
(RefSeq) 3-phosphoinositide dependent protein kinase 1
  KO
K06276  3-phosphoinositide dependent protein kinase-1 [EC:2.7.11.1]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu01524  Platinum drug resistance
ocu03320  PPAR signaling pathway
ocu04068  FoxO signaling pathway
ocu04071  Sphingolipid signaling pathway
ocu04140  Autophagy - animal
ocu04150  mTOR signaling pathway
ocu04151  PI3K-Akt signaling pathway
ocu04152  AMPK signaling pathway
ocu04210  Apoptosis
ocu04510  Focal adhesion
ocu04660  T cell receptor signaling pathway
ocu04664  Fc epsilon RI signaling pathway
ocu04722  Neurotrophin signaling pathway
ocu04910  Insulin signaling pathway
ocu04919  Thyroid hormone signaling pathway
ocu04931  Insulin resistance
ocu04960  Aldosterone-regulated sodium reabsorption
ocu05145  Toxoplasmosis
ocu05205  Proteoglycans in cancer
ocu05213  Endometrial cancer
ocu05215  Prostate cancer
ocu05223  Non-small cell lung cancer
ocu05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100347954 (PDPK1)
   04071 Sphingolipid signaling pathway
    100347954 (PDPK1)
   04151 PI3K-Akt signaling pathway
    100347954 (PDPK1)
   04152 AMPK signaling pathway
    100347954 (PDPK1)
   04150 mTOR signaling pathway
    100347954 (PDPK1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100347954 (PDPK1)
  09143 Cell growth and death
   04210 Apoptosis
    100347954 (PDPK1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100347954 (PDPK1)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    100347954 (PDPK1)
   04664 Fc epsilon RI signaling pathway
    100347954 (PDPK1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100347954 (PDPK1)
   03320 PPAR signaling pathway
    100347954 (PDPK1)
   04919 Thyroid hormone signaling pathway
    100347954 (PDPK1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100347954 (PDPK1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100347954 (PDPK1)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100347954 (PDPK1)
   05231 Choline metabolism in cancer
    100347954 (PDPK1)
  09162 Cancer: specific types
   05215 Prostate cancer
    100347954 (PDPK1)
   05213 Endometrial cancer
    100347954 (PDPK1)
   05223 Non-small cell lung cancer
    100347954 (PDPK1)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    100347954 (PDPK1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100347954 (PDPK1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100347954 (PDPK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ocu01001]
    100347954 (PDPK1)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100347954 (PDPK1)
Enzymes [BR:ocu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100347954 (PDPK1)
Protein kinases [BR:ocu01001]
 Serine/threonine kinases: AGC group
  PDK1 family
   100347954 (PDPK1)
Membrane trafficking [BR:ocu04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Acrosomal exocytosis proteins
    100347954 (PDPK1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Pkinase_fungal Kdo APH
Other DBs
NCBI-GeneID: 100347954
NCBI-ProteinID: XP_008250214
Ensembl: ENSOCUG00000002145
LinkDB
Position
Un
AA seq 450 aa
MARTTSHLYDAVPIQSSVVLCSCPSPSMVRTQTESSAAPGIPSGGSRQSPTMEGTTAEAR
PSANALQHAAQPPPQPRKKRPEDFKFGKILGEGSFSTVVLARELATSREYAIKILEKRHI
IKENKVPYVTRERDVMSRLDHPFFVKLYFTFQDDEKLYFGLSYAKNGELLKYIRKIGSFD
ETCTRFYTAEIVCALEYLHGKGVIHRDLKPENILLNEDMHIQITDFGTAKVLSPASKQAR
ANSFVGTAQYVSPELLTEKSACKSSDLWALGCIIYQLVAGLPPFRAGNEYLIFQKIIKLE
YDFPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLKAHPFFESITWENLHQQTPPKL
TAYLPAMSEDDEDCYGNYDNLLSQFGCLQVSASSSSHSLSAADAGPPQRSGSNIEQYIHD
LDTNSFELDLQFSEDEKKLLLEKQAGGNPW
NT seq 1353 nt   +upstreamnt  +downstreamnt
atggccaggaccaccagccacttgtatgacgccgtccccatccagtccagcgtggtgtta
tgttcctgcccatccccatccatggtgagaacccagactgagtccagcgcagcccctggc
atccccagcggtggcagcaggcagagccccaccatggagggcaccacagccgaggcccgg
cccagtgccaacgccctgcagcatgctgcccagccaccgccacagcctcggaagaaacgg
cctgaagacttcaaatttgggaagattctgggcgaaggctccttctcaaccgttgtcctg
gctcgagaactggcaacctccagagaatatgctattaaaatcctggagaagcggcatatt
ataaaagagaacaaggttccgtatgtgaccagagagcgggatgtgatgtcgcgcctggat
caccccttctttgttaagctttacttcacttttcaggacgacgaaaagctctattttggt
cttagttatgccaaaaatggagaactacttaaatacattcgcaaaatcggttcctttgat
gagacctgtacgcgattttacactgccgagattgtgtgtgctttagagtacttgcatggc
aagggcgtcatccacagggacctgaaaccggagaacatcctgttgaatgaagacatgcac
atccagatcacagacttcggaacagcaaaggtgttgtctccggcgagcaagcaagccagg
gccaactcgttcgtgggaacggcgcagtatgtctctccagagctgctcacggagaagtcg
gcctgcaaaagttcagacctttgggctctgggatgcataatataccagctcgtggcagga
ctaccaccgttccgagccggaaatgaatatcttatatttcagaagatcattaaattggaa
tatgactttccagaaaaattcttccctaaggcaagagaccttgtggaaaaacttttggtt
ttagatgccacaaagcggttaggctgtgaagagatggaagggtatggccctctcaaagct
catccattcttcgagtccatcacgtgggagaatctgcaccagcagacgcctccgaagctc
acggcctacctaccggccatgtctgaggatgacgaggactgctatggcaattatgacaac
ctcctgagccagtttggctgcttgcaggtgtcggcgtcgtcctcctcgcactccctgtcc
gcagcagatgccggcccgccccagaggtcaggcagcaacatagagcagtacatccacgac
ttggacactaattcttttgaactggacctgcagttttctgaagatgagaagaagttgtta
ctggagaagcaggctggtggaaacccctggtaa

DBGET integrated database retrieval system