KEGG   Oryctolagus cuniculus (rabbit): 100348477
Entry
100348477         CDS       T03373                                 

Gene name
CASP8
Definition
(RefSeq) caspase 8
  KO
K04398  caspase 8 [EC:3.4.22.61]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu01524  Platinum drug resistance
ocu04115  p53 signaling pathway
ocu04210  Apoptosis
ocu04215  Apoptosis - multiple species
ocu04217  Necroptosis
ocu04620  Toll-like receptor signaling pathway
ocu04621  NOD-like receptor signaling pathway
ocu04622  RIG-I-like receptor signaling pathway
ocu04625  C-type lectin receptor signaling pathway
ocu04657  IL-17 signaling pathway
ocu04668  TNF signaling pathway
ocu04932  Non-alcoholic fatty liver disease
ocu05010  Alzheimer disease
ocu05016  Huntington disease
ocu05022  Pathways of neurodegeneration - multiple diseases
ocu05132  Salmonella infection
ocu05134  Legionellosis
ocu05142  Chagas disease
ocu05145  Toxoplasmosis
ocu05152  Tuberculosis
ocu05160  Hepatitis C
ocu05161  Hepatitis B
ocu05162  Measles
ocu05163  Human cytomegalovirus infection
ocu05164  Influenza A
ocu05165  Human papillomavirus infection
ocu05167  Kaposi sarcoma-associated herpesvirus infection
ocu05168  Herpes simplex virus 1 infection
ocu05169  Epstein-Barr virus infection
ocu05170  Human immunodeficiency virus 1 infection
ocu05200  Pathways in cancer
ocu05203  Viral carcinogenesis
ocu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    100348477 (CASP8)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100348477 (CASP8)
   04215 Apoptosis - multiple species
    100348477 (CASP8)
   04217 Necroptosis
    100348477 (CASP8)
   04115 p53 signaling pathway
    100348477 (CASP8)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100348477 (CASP8)
   04621 NOD-like receptor signaling pathway
    100348477 (CASP8)
   04622 RIG-I-like receptor signaling pathway
    100348477 (CASP8)
   04625 C-type lectin receptor signaling pathway
    100348477 (CASP8)
   04657 IL-17 signaling pathway
    100348477 (CASP8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100348477 (CASP8)
   05203 Viral carcinogenesis
    100348477 (CASP8)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100348477 (CASP8)
   05016 Huntington disease
    100348477 (CASP8)
   05022 Pathways of neurodegeneration - multiple diseases
    100348477 (CASP8)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100348477 (CASP8)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100348477 (CASP8)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100348477 (CASP8)
   05134 Legionellosis
    100348477 (CASP8)
   05152 Tuberculosis
    100348477 (CASP8)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100348477 (CASP8)
   05162 Measles
    100348477 (CASP8)
   05164 Influenza A
    100348477 (CASP8)
   05161 Hepatitis B
    100348477 (CASP8)
   05160 Hepatitis C
    100348477 (CASP8)
   05168 Herpes simplex virus 1 infection
    100348477 (CASP8)
   05163 Human cytomegalovirus infection
    100348477 (CASP8)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100348477 (CASP8)
   05169 Epstein-Barr virus infection
    100348477 (CASP8)
   05165 Human papillomavirus infection
    100348477 (CASP8)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100348477 (CASP8)
   05142 Chagas disease
    100348477 (CASP8)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100348477 (CASP8)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ocu01002]
    100348477 (CASP8)
Enzymes [BR:ocu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.61  caspase-8
     100348477 (CASP8)
Peptidases and inhibitors [BR:ocu01002]
 Cysteine peptidases
  Family C14: caspase family
   100348477 (CASP8)
SSDB
Motif
Pfam: Peptidase_C14 DED PYRIN
Other DBs
NCBI-GeneID: 100348477
NCBI-ProteinID: XP_017198518
LinkDB
Position
7
AA seq 478 aa
MDLSSCLYKIGEQLDSEELASLKFLSLDYIPQRKQEPIQDALMLFQRLQEKRMLEENNLA
FLKELLFRIHRLDLLSTLLGTSKEEMVTELQIPGRAHISAYRVMLFQISEDVSQLELKAF
KFFLSREISKCKLEDNMSLLDIFIEMEKRALLGDRNLDTLKKICEQINKSLLVKIHDYED
CSQGRRMSLGRTPGACSNGEEPYGVLALSDCPGEPASKAQTSEEVYQMKSKPRGYCLIVN
NYDFSIARREMPRHRNMKDRKGTEVDAEALSNTFTDLHFEVVHYNDCTAKQICDILQSYQ
SMDHKDRDCFVCCILSHGDKGIIYGTDGQEACIYDLTSYFTGSKCPSLAGKPKVFFIQAC
QGDKYQQAVPVAIDSEQQETYLEMDSSFPKRYVPDEADFLLGMATVNNCVSYRNLFEGTW
YIQSLCQSLRERCPQGEDILSILTKVNYKVSIKEAGEKKKQMPQPTFTLTKRLLFPLD
NT seq 1437 nt   +upstreamnt  +downstreamnt
atggatttatccagttgtctttacaaaattggggagcagctggacagcgaggagctggcc
tccctgaagttcctgagcctggattacatcccacaaaggaagcaggagcccatccaggat
gccttgatgctattccagagactccaggagaagcgcatgctggaggagaacaacctggcc
ttcctgaaggagctgctcttccgaatccacagactggatctgctgagcactctgctgggc
actagcaaggaggagatggtgacggagctgcagatcccaggcagggcccatatttctgcc
tacagggtcatgctcttccagatttcagaagacgtaagccaactggaattgaaggctttt
aaattttttttgagcagggagatctccaaatgtaaactggaagataacatgagcttgctg
gacatcttcatcgagatggagaagagggccctccttggggatagaaacttggacaccctg
aaaaagatctgtgagcaaatcaacaagagcctgctggtgaaaatccacgattatgaagac
tgcagccaagggagaagaatgagcctgggaagaactcccggcgcatgttcaaacggggag
gagccatatggagtgctggcactgtcagactgtccaggggagccagcgagcaaggcacag
acatcagaagaagtttaccaaatgaaaagcaaacctcggggatactgtttgatcgtcaac
aactacgattttagcatagcacggagagaaatgcccagacaccgcaacatgaaagacagg
aaaggaacagaagttgatgcagaggctttgagcaataccttcactgaccttcactttgaa
gtagtccattacaatgactgcacggcaaagcagatctgtgacattctgcaaagctaccaa
agcatggaccacaaagacagagactgcttcgtctgctgcatcctgtcccatggagacaag
ggcatcatctatggcactgatgggcaggaggcctgcatctatgatctgacctcttatttc
actggttcgaagtgcccctctcttgctggaaaacccaaagtctttttcattcaagcttgt
caaggggataagtaccagcaagccgttcctgttgcgatagactcagagcagcaagaaacc
tatttagaaatggactcatcgtttccaaagagatacgtccccgatgaggctgacttcctg
ctggggatggccactgtgaacaactgtgtctcctatcgaaacctctttgaggggacctgg
tacatccagtcactttgccagagcctaagagaaagatgtcctcaaggcgaagatatcctc
tccatcctgaccaaagtgaactataaagtgagcattaaggaagctggggaaaaaaagaag
cagatgccacagcctactttcacactaacaaagagactcctcttccctctggattga

DBGET integrated database retrieval system