KEGG   Oryctolagus cuniculus (rabbit): 100351382
Entry
100351382         CDS       T03373                                 

Gene name
PML
Definition
(RefSeq) promyelocytic leukemia
  KO
K10054  probable transcription factor PML
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04120  Ubiquitin mediated proteolysis
ocu04144  Endocytosis
ocu05164  Influenza A
ocu05168  Herpes simplex virus 1 infection
ocu05200  Pathways in cancer
ocu05202  Transcriptional misregulation in cancer
ocu05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100351382 (PML)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100351382 (PML)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100351382 (PML)
   05202 Transcriptional misregulation in cancer
    100351382 (PML)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    100351382 (PML)
  09172 Infectious disease: viral
   05164 Influenza A
    100351382 (PML)
   05168 Herpes simplex virus 1 infection
    100351382 (PML)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ocu04121]
    100351382 (PML)
Ubiquitin system [BR:ocu04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRIM/RBCC proteins
    100351382 (PML)
SSDB
Motif
Pfam: DUF3583 zf-B_box Imm71 PNMA DUF4455
Other DBs
NCBI-GeneID: 100351382
NCBI-ProteinID: XP_002723888
Ensembl: ENSOCUG00000002183
UniProt: G1SH00
LinkDB
Position
Un
AA seq 860 aa
MQQDPAPAGSPGSQRDAGPTRTPTMASPELRSEGAPRSPSPAEQAEEEDFQFLQCQGCHT
QAKCPKLLPCLHTLCSGCLEAPGLHCPICQGPRALDGAPVLDNIFFESLQRRLAVHQQVV
DMQAACTRCKEPADFWCFECEQLLCSRCFEAHQWFLKHEARPLAELRSQSVLEFLESTRK
SNNIFCSNPNHRSPMLTSIYCRGCHKPLCCSCALLDSGHSDLKCDLSAEVLQRQDELDAT
ARALRERGGAFGAALAQVRAAIGQLGRARADAEDLIRERVRQVVAHVQAQERELLQQVHA
CYQRDYEELAARLSRLEAVLQRMRTGGALVRRMKHYASDQEVLDMHGFLHEALCRLRQEE
PQGPQAAVRAEGFDEFKVRLQDLVARVTQATDAILSRRTSPQSASTPGDLLHVDLPEQAQ
KMQAPPMAVVQSVPGAHPVPLYVFSIRDTSSAEEDSGTLVGRKRKSCYTQCPQKMIKLES
EEKERPAQSSPEQPRPSTSKAVSPPQLDGTPSPGSPNVGEEVDPANSNHVAGDDPEEAEE
RVVVISSSEDSDDTEIAPRQELDTSSSESSDLQLEGLSSPRAPDVNLADPHAEDRPLVFF
DLKIDSETQKISQLAAVNRETKFRVLIQPGAFSVCSKAVSLEAGLQHFLGFLGAMRRPVL
ACYSLWGPSLSVFLRALEDMNKLGAFQEAVSGFLALLPLVRELVPGASSFKLKSLAETYL
ARSMSEGSALAAVLAMRDLCLLLEVSPGRQLARHVHSFHSMQCFSSLQPLVQAAILSRAE
ARLLALHKASFQELLSAHRGDPQQGLEKYCRSLGLRATAPAPALPTPRLQALSAYFQRLS
EGTSASVDGHSLEQGAAQQS
NT seq 2583 nt   +upstreamnt  +downstreamnt
atgcagcaggatcccgcgcccgccgggtccccgggctcccagcgcgacgccggcccgacc
cgcacccccaccatggcgtccccggagttgcgctccgaaggtgccccacgtagccccagc
cccgcagagcaagccgaggaggaagacttccagttcctgcagtgccagggctgccacacc
caagccaagtgccccaagctgctgccttgcctgcacacgctgtgctcggggtgcctggag
gcgccgggcctgcactgccccatctgccaggggccccgggccctagacggggcgcccgtc
ctggacaacatcttcttcgagagtctgcagcggcgcctggccgtgcaccagcaggtggtg
gacatgcaggccgcctgcacgcgctgcaaggagcccgccgacttctggtgcttcgagtgc
gagcagctcctgtgttccaggtgcttcgaggcgcaccagtggttcctgaagcacgaggcg
cggccgctggccgagctgcgcagccagtcggtgctggagttcctggagagcacgcgcaag
tccaacaacatcttctgctccaaccccaaccaccgcagcccgatgctgaccagcatctac
tgccggggctgccacaagcccctgtgctgctcgtgtgcgctcctggacagcggccacagc
gacctcaagtgcgacctgagcgccgaggtgctgcagcgccaggacgagctggacgccacg
gcgcgcgcgctgcgggagcgcggcggcgccttcggggctgcgctcgcgcaggtgcgcgcg
gccatcgggcagctgggccgcgcgcgcgccgacgccgaggacctgatccgcgagcgcgtg
cgccaggtggtggcacacgtgcaggcgcaggagcgcgagctgctgcagcaggtgcacgcg
tgctaccagcgcgactatgaggagctggcggcccggctgagccgcctggaagccgtgctg
cagcgcatgcgcacgggcggcgcgctcgtgcggaggatgaagcactacgcgtcggaccag
gaggtgctggacatgcatggcttcctgcacgaggctctctgccgcttgcgccaggaggag
ccccagggcccgcaggccgccgtgcgcgctgagggctttgacgagttcaaggtgcgcctg
caggacctcgtggcgcgcgtcacccaggccacagacgcaattctgtccaggagaaccagc
ccgcagtctgccagtacccccggcgacctgctgcatgtggacctgcccgagcaggcacag
aagatgcaggcgccgcccatggccgtggtgcagtcggtgcccggggcccaccctgtgccc
ctgtacgtcttctccatcagagacacctccagtgcagaggaggactccggcaccctcgtg
ggccggaagaggaagtcctgttacacccagtgcccgcaaaagatgatcaagctggagtcg
gaggagaaggagaggccggcccagagctccccggagcagcccagacccagcacctccaag
gcagtgtcaccgccccaactggacgggacccccagccccgggagccccaacgtcggagaa
gaggtcgacccggccaacagcaaccacgtggctggcgatgacccggaggaggcagaggag
cgcgtggtggtgatcagcagctcagaggactccgatgacaccgagatcgcgccccgccag
gagctggacaccagcagcagcgagtccagtgacctccagctggagggcctcagctccccg
cgggccccggacgtgaacctggctgatccccacgcagaagacaggcccctggtcttcttt
gacctcaagatcgacagtgaaacccagaagattagccagctggcggccgtgaaccgcgag
accaagttccgggtgctcatccagcctggagccttcagcgtctgctccaaggcggtgtcc
ctggaggcggggctgcagcacttccttggcttcctgggcgccatgcgccgccccgtcctg
gcctgctactcgctgtggggccccagcctctccgtcttcctccgggccctggaagacatg
aacaagctgggggccttccaggaggccgtgtcgggcttcctggccctcctgcccctcgtg
cgcgaactcgtgcccggagccagcagcttcaagctcaagagcctggccgagacctacctg
gcgagaagcatgagcgagggcagcgccctggcagccgtgctggccatgcgtgacctgtgc
ctcctgctggaggtctcccccggccggcagctggcccggcacgtgcactccttccacagc
atgcagtgcttttcctccctgcagccgctggtgcaggcggccatcctgtcccgggccgag
gcccgcctgctggccctgcacaaggccagcttccaggagcttctgagtgcgcaccgcggc
gacccgcagcagggcttggagaagtactgccgctccctgggccttcgagccacggcgccg
gccccggccctgcccactcccaggctgcaggctctgagcgcctacttccagcgcctgtcc
gagggcacatctgcctctgtcgatggccacagcctggaacaaggcgccgcccagcagagc
tga

DBGET integrated database retrieval system