KEGG   Oryctolagus cuniculus (rabbit): 100355930Help
Entry
100355930         CDS       T03373                                 

Gene name
TDG
Definition
(RefSeq) thymine DNA glycosylase
  KO
K20813  thymine-DNA glycosylase [EC:3.2.2.29]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    100355930 (TDG)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ocu03400]
    100355930 (TDG)
Enzymes [BR:ocu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.29  thymine-DNA glycosylase
     100355930 (TDG)
DNA repair and recombination proteins [BR:ocu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     100355930 (TDG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDG
Motif
Other DBs
NCBI-GeneID: 100355930
NCBI-ProteinID: XP_008255220
Ensembl: ENSOCUG00000016313
LinkDB All DBs
Position
4
AA seq 406 aa AA seqDB search
MEAENAGSYSLQQAQAFYTFPFQQMMAEAPDMPIVNEQQMPAEVAAPAPAEEPVQEAPKG
RKRKTRATEPKKPAEPKKPAEAKKSGKSAKSKEKQEKITDAFKVKRKVDRFNGVSEAELL
TKTLPDILTFNLDIVIIGINPGLMAAYKGHHYPGPGNHFWKCLFMSGLSEVQLNHMDDHT
LPGKYGIGFTNMVERTTPGSKDLSSKEFREGGRILVQKLQKYQPRIAVFNGKCIYEIFSR
EVFGVKVKNLEFGLQPHKIPDTETLCYVMPSSSARCAQFPRAQDKVHYYIKLKDLRDQLK
GIERNTDVQEVRYTFDLQLAQEDAKKMAVKEEKYDPGYEAAYGGAYSDNPCNSEPCSFPS
NGLAADSAELRESALNAIPDGQWMAQPFTDQIPSLNNHCGAQEQGV
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atggaagcggagaacgcgggcagctattcccttcagcaggctcaggctttttacacgttt
ccctttcaacaaatgatggccgaggctcccgatatgccgattgtgaacgaacagcaaatg
cccgcagaagtcgcagcccccgctcctgctgaggaacctgtacaagaggctccaaaagga
agaaaaagaaaaactcgagcaacagaacccaaaaaaccagcagaacccaaaaaacctgct
gaggcaaaaaaatctggcaaatctgccaagtcaaaggaaaagcaagaaaaaattacagat
gcgtttaaggtgaaaaggaaagtggaccgttttaatggcgtgtcagaggctgaacttctg
accaagactctccctgatattttgaccttcaacctggacattgtaattattggcataaat
ccaggactaatggctgcttacaaaggacatcattaccctggacctggaaaccatttttgg
aagtgtctgttcatgtcagggctgagtgaggtccagctgaaccacatggacgatcacact
ttacctgggaagtatggcattggatttaccaatatggtggagaggacgacgccaggcagc
aaggatctttccagtaaagaatttcgtgaaggaggacgtattctagtccagaaattacag
aaatatcagccacgaatagcagtgtttaatggaaaatgtatttatgaaatttttagtaga
gaagtttttggagtaaaggttaagaacttggaatttgggcttcaaccccacaagattcca
gacacagaaactctctgctatgtgatgccatcatccagtgcaaggtgtgctcagtttcct
cgcgctcaggacaaagttcattactacattaagttgaaggacttaagagatcagttgaaa
ggcattgaacgaaacacagacgttcaagaagtgcggtatacatttgacctacagcttgcc
caagaggatgcaaagaagatggctgttaaggaagaaaaatacgatcctggttatgaagca
gcctacggtggtgcttacagtgacaacccgtgcaatagtgaaccttgcagcttcccgtct
aatgggctagctgcggacagtgcggagttaagagaatcagctctcaatgccattccagat
gggcagtggatggcccagccgtttacagaccagattccttccctgaacaatcactgtgga
gcgcaagagcagggtgtctaa

DBGET integrated database retrieval system