KEGG   Oryctolagus cuniculus (rabbit): 100357431
Entry
100357431         CDS       T03373                                 

Gene name
RB1
Definition
(RefSeq) RB transcriptional corepressor 1
  KO
K06618  retinoblastoma-associated protein
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu01522  Endocrine resistance
ocu04110  Cell cycle
ocu04218  Cellular senescence
ocu04934  Cushing syndrome
ocu05160  Hepatitis C
ocu05161  Hepatitis B
ocu05163  Human cytomegalovirus infection
ocu05165  Human papillomavirus infection
ocu05166  Human T-cell leukemia virus 1 infection
ocu05167  Kaposi sarcoma-associated herpesvirus infection
ocu05169  Epstein-Barr virus infection
ocu05200  Pathways in cancer
ocu05203  Viral carcinogenesis
ocu05212  Pancreatic cancer
ocu05214  Glioma
ocu05215  Prostate cancer
ocu05218  Melanoma
ocu05219  Bladder cancer
ocu05220  Chronic myeloid leukemia
ocu05222  Small cell lung cancer
ocu05223  Non-small cell lung cancer
ocu05224  Breast cancer
ocu05225  Hepatocellular carcinoma
ocu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100357431 (RB1)
   04218 Cellular senescence
    100357431 (RB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100357431 (RB1)
   05203 Viral carcinogenesis
    100357431 (RB1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100357431 (RB1)
   05225 Hepatocellular carcinoma
    100357431 (RB1)
   05226 Gastric cancer
    100357431 (RB1)
   05214 Glioma
    100357431 (RB1)
   05220 Chronic myeloid leukemia
    100357431 (RB1)
   05218 Melanoma
    100357431 (RB1)
   05219 Bladder cancer
    100357431 (RB1)
   05215 Prostate cancer
    100357431 (RB1)
   05224 Breast cancer
    100357431 (RB1)
   05222 Small cell lung cancer
    100357431 (RB1)
   05223 Non-small cell lung cancer
    100357431 (RB1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100357431 (RB1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100357431 (RB1)
   05161 Hepatitis B
    100357431 (RB1)
   05160 Hepatitis C
    100357431 (RB1)
   05163 Human cytomegalovirus infection
    100357431 (RB1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100357431 (RB1)
   05169 Epstein-Barr virus infection
    100357431 (RB1)
   05165 Human papillomavirus infection
    100357431 (RB1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100357431 (RB1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ocu01009]
    100357431 (RB1)
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ocu03000]
    100357431 (RB1)
Protein phosphatases and associated proteins [BR:ocu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100357431 (RB1)
Transcription factors [BR:ocu03000]
 Eukaryotic type
  Other transcription factors
   Pocket domain Rb
    100357431 (RB1)
SSDB
Motif
Pfam: Rb_C RB_A RB_B DUF3452 RuvC_1 TFIIB
Other DBs
NCBI-GeneID: 100357431
NCBI-ProteinID: XP_002720769
Ensembl: ENSOCUG00000016404
UniProt: G1TBK6
LinkDB
Position
Un
AA seq 927 aa
MPPKTPRRAAAAAAAAVEPPAPPPPPPPEEDAEQDSGPEDLPLARLEFEETEDPDFTALC
QKLKIPDHVRERAWLTWEKVSSVDGVLEGYIQKKKELWGICVFIAAVDLDEMPFTFTELQ
KNIEISVYKFFDLLKEIDTSTKVDNAMSRLLKKYNVLCALYSKLERTCELIYLTQPSSSV
STEINSLLVLKVSWITFLLAKGEVLQMEDDLVISFQLMLCVLDYFIKLSPPALLKEPYKT
AVIPVNGSPRAPRRGQNRSARIAKQPEQDTRIIDMLCKEHDCNIDEVKNVYFKNFIPFMN
SLGIVAFNGLPEVESLSKRYEEIYLKNKDLDARLFLDHDETLQNDPLDSFELQRTPRKNN
PDEEVNVIPPHTPVRTVMNTIQQLMMILNSASDQPSENLISYFNNCTVNPKENILKRVKD
IGCIFKEKFAKAVGQGCVDIGSQRYKLGVRLYYRVMESMLKSEEERLSIQNFSKLLNDNI
FHMSLLACALEVVMATYSRSTSQNLDSGTDLSFPWILNVLNLKAFDFYKVIESFIKAEAN
LTREMIKHLERCEHRIMESLAWLSDSPLFDLIKQSKDREGPADHFESACPLNLPLQNNHT
AADMYLSPVRSPKKKSSTTRVNSTANVETQATSAFQTQKPVKSTSLSLFYKKVYRLAYLR
LNTLCARLLSDHPELEHIIWTLFQHTLQNEYELMRDRHLDQIMMCSMYGICKVKNIDLKF
KIIVTAYKDLPHAVQETFKRVLIREEEYDSIIVFYNSVFMQRLKTNILQYASTRPPTLSP
IPHIPRSPYKFSSSPLRIPGGNIYISPLKSPYKISEGLPTPTKMTPRSRILVSIGESFGT
SEKFQKINQMVCNSDRVLKRSAEGSNPPKPLKKLRFDIEGTDEADGSKHIPGESKFQQKL
AEMTSTRTRMQKQKMNDNMDTSNKEEK
NT seq 2784 nt   +upstreamnt  +downstreamnt
atgccgcccaaaaccccgagaagagcagctgccgccgccgccgccgcggtggaacccccg
gcgccgccgccgccgccgcctcctgaggaggacgcggaacaggacagtggtcctgaggac
ttgcctctggccaggcttgagtttgaagaaactgaagaccccgattttactgcattatgt
cagaaattaaagataccagatcatgtcagagaaagagcttggttaacttgggagaaagta
tcatctgtggatggagtattggaaggttatattcaaaagaaaaaggaattgtggggaatc
tgtgtctttattgcagcagttgacctcgatgagatgccattcacttttactgagctacag
aaaaacatagaaataagtgtctataaattttttgacttactaaaagaaattgataccagt
accaaagttgataatgctatgtcaagattgttgaagaaatataatgttttgtgtgcactc
tacagcaaattagaaaggacatgtgaacttatatatttaacacaacccagcagttcggta
tctactgaaataaattctctgttggtgctaaaagtttcttggatcacgtttttactagct
aaaggagaggtattacaaatggaagatgacctggtgatctcatttcagttaatgttgtgt
gttcttgactattttatcaaactctcacctcctgcattactcaaagaaccatataaaaca
gctgtaatacctgttaatggttcacctcgagcacccaggcgagggcaaaacagaagtgcc
cggatagcaaaacagccagagcaagatacaagaattattgacatgctctgtaaagaacat
gattgtaatatagatgaggtgaaaaatgtttatttcaaaaattttattccatttatgaat
tctcttggaattgttgcttttaatggacttccagaggttgaaagtctctctaaacgatat
gaagaaatttatcttaaaaacaaagatctagatgcaagattatttttggatcatgatgaa
actctccagaatgatcctttggacagttttgaattgcagagaacaccacgaaaaaataat
cctgatgaagaagtaaatgtgattcctccacacactccagttaggactgttatgaatacc
attcaacaattaatgatgattttaaactcagcaagtgatcaaccttcagaaaatctgatt
tcctatttcaataactgcacagtgaatccaaaagaaaatattctgaaaagagtgaaggat
attggatgcatctttaaagaaaaatttgccaaagctgtgggacagggttgtgttgatatt
ggatcacagcgatacaaacttggagtccgattatattaccgagtaatggaatccatgctt
aaatcagaagaagagcgattatccattcaaaattttagcaaactcctgaatgacaacatc
tttcatatgtctttattggcgtgtgctctagaagttgtaatggctacatatagcagaagt
acatctcagaatcttgattctggaacagatttgtccttcccatggattctgaatgtactt
aatttaaaagcctttgatttttacaaagtgattgaaagttttatcaaagctgaagctaac
ttgacaagagaaatgataaaacatttagaacgatgtgagcatcgaatcatggaatccctt
gcatggctttcagattcacctttatttgatcttattaaacagtcaaaggacagagaggga
ccagctgatcattttgaatctgcttgtcctctcaaccttcctctccaaaataatcacact
gcagcagatatgtatctttctcctgtaagatccccaaagaaaaaaagttcaaccacacgt
gtaaattctactgcaaatgtagagacacaagcaacctcagccttccagactcagaagcca
gtgaaatctacctccctttcactcttttacaaaaaagtgtaccggctagcatatctccga
ctaaataccctatgtgcacgccttctgtctgaccacccagaactagagcacatcatctgg
acccttttccagcacactctgcaaaatgagtatgaactcatgagagataggcatttggac
cagattatgatgtgttccatgtatggcatatgcaaagtaaagaacatagatcttaaattc
aaaatcattgtgacagcatacaaggatcttcctcatgctgttcaggagacattcaaacgt
gttttgataagagaagaagaatatgactccattatagtattctacaactcggtcttcatg
cagaggctgaaaacaaatattttgcagtatgcttccaccaggccccctaccttgtcacca
atacctcacattcctcgaagcccttacaaattttctagttcgcccttacggattcctggg
gggaatatctatatatcacccctgaagagtccatataaaatttcagaaggtttgccaaca
ccaacaaaaatgactccaagatcaagaatcttagtatcaattggtgaatcttttgggact
tctgagaagttccagaaaataaaccagatggtatgtaacagcgatcgagtgctcaaaaga
agtgctgaaggaagcaaccctcccaaacccctgaaaaaactgcgttttgatattgaagga
acggatgaagccgatggaagtaaacatattccaggggagtccaaatttcaacagaaactt
gcagaaatgacatctactcgaacaagaatgcagaagcaaaaaatgaatgataatatggat
acctcaaacaaggaagaaaagtga

DBGET integrated database retrieval system