KEGG   Oryctolagus cuniculus (rabbit): 100357844
Entry
100357844         CDS       T03373                                 

Gene name
PLG
Definition
(RefSeq) plasminogen
  KO
K01315  plasminogen [EC:3.4.21.7]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04080  Neuroactive ligand-receptor interaction
ocu04610  Complement and coagulation cascades
ocu05150  Staphylococcus aureus infection
ocu05164  Influenza A
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100357844 (PLG)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    100357844 (PLG)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    100357844 (PLG)
  09172 Infectious disease: viral
   05164 Influenza A
    100357844 (PLG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ocu01002]
    100357844 (PLG)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ocu04147]
    100357844 (PLG)
Enzymes [BR:ocu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.7  plasmin
     100357844 (PLG)
Peptidases and inhibitors [BR:ocu01002]
 Serine peptidases
  Family S1: chymotrypsin family
   100357844 (PLG)
Exosome [BR:ocu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100357844 (PLG)
SSDB
Motif
Pfam: Kringle Trypsin PAN_1 DUF1986 Trypsin_2 DUF3719
Other DBs
NCBI-GeneID: 100357844
NCBI-ProteinID: XP_017200963
Ensembl: ENSOCUG00000001766
LinkDB
Position
12
AA seq 811 aa
MEQRAVVLLLLLLLKPGQAEPLDDYVNTQGASLFSFTKKQLGAASIAECAARCEAETEFT
CRSFQYHSKEQQCVVMAENSKSSAIIRRRDVVLFEKRMYLSECKIGNGRSYRGTKSKTKT
GFTCQKWSSSYPHKPNFTPKKYPAEGLEENYCRNPDNDEQGPWCYTTNPDERFDYCDIPE
CEDECMHCSGENYEGKISKTMSGIECQAWDSQSPHAHGYIPSKFPNKNLKKNYCRNPDGE
PRPWCFTMDPKKRWELCDIPRCTTPPPPSGPTHQCLKGRGESYRGKVARTKSGLTCQRWS
EQTPHLHNRTPENFPCKDLDENYCRNPDGESAPWCYTTDSKVRWEHCDIPSCASSPTSVE
PLDAPAPPEETPVVQECYQGNGQSYRGTSSTTITGRKCQSWLSMTPHRHQRTPQNYPNAD
LTMNYCRNPDDDIRPWCYTTDPSVRWEYCNLRRCSEPAASPAATVPTAQLPRPEATFEPD
CMFGNGKGYRGKKATTADGTPCQGWAAQEPHRHNIFTPETNPRAGLERNYCRNPDGDTNG
PWCYTMNPRKLYDYCDVPQCASSSSYDCGKPKVEPKKCPGRVVGGCVANPHSWPWQISLR
TRTGQHFCGGTLIAPEWVLTAAHCLEKYPRPSAYRVILGAHKEVNLELDVQDIDVAKLFL
EPSRADIALMKLSSPAVITDKVIPACLPSSNYVVADRTECYITGWGETQGTYGAGLLKEA
QLPVIENKVCNRFEYLNGRVRSTELCAGHLAGGTDSCQGDSGGPLVCFEKDKYILQGVTS
WGLGCARPNKPGVYVRVSRFVDWIERTMRNN
NT seq 2436 nt   +upstreamnt  +downstreamnt
atggagcagagggcagtagtccttctccttctcttacttctgaaaccaggtcaagcagaa
cccctggatgactacgtgaacacccagggggcctcgctgttcagtttcaccaagaagcag
ctgggagcagcgagcatagcagagtgtgcagcgagatgtgaggcggagacggagttcacg
tgcaggtccttccaataccacagcaaagagcagcagtgcgtggtcatggctgagaacagc
aagtcctcggccatcatcaggaggcgggacgtggtgctgtttgagaagagaatgtatctc
tcagagtgcaagatcgggaacgggaggagctacagagggacgaagtccaagacgaaaact
ggcttcacctgtcagaaatggagctccagttacccccacaaaccaaacttcacacccaaa
aagtaccccgcggagggcctggaggagaactactgccggaacccagacaacgacgagcag
gggccctggtgctacacgaccaacccagacgagcgattcgactactgcgacatcccggag
tgtgaagatgaatgtatgcactgcagcggagaaaattatgaaggcaaaatttccaagacg
atgtctggcattgaatgccaggcctgggactcgcagagcccgcatgcgcacggctacatc
ccttccaaatttcccaacaagaacctgaagaagaattactgccggaaccccgacggcgag
ccgcgcccctggtgcttcaccatggaccccaaaaagcgctgggagctctgtgacatcccg
cgctgcaccacacccccgcccccttctggcccgacccaccagtgcctgaaggggaggggt
gagagctaccgagggaaggtggcccgcaccaagtccgggctcacctgtcagcgctggagt
gagcagacccctcacctccacaacaggaccccggaaaacttcccctgcaaagacctggat
gaaaactactgtcggaacccggatggagagtcggctccgtggtgctacacgaccgacagc
aaggtgcggtgggagcactgtgacatcccgtcctgtgcctcctcgcccacgtccgtggag
cccctggatgccccagcaccacccgaggaaacccccgtggtccaggagtgctaccagggc
aacgggcagagctatcgagggacgtcatccaccaccatcacagggcggaaatgccagtct
tggctgtcgatgacaccacaccggcatcagaggaccccacagaactacccgaatgcggac
ctgacaatgaactactgcaggaaccccgacgatgacatccgcccgtggtgctacaccacc
gacccgagcgtcagatgggaatactgcaacctgcggaggtgctcggagccggccgccagc
ccggcagccactgtacccacggcccagctccccaggccggaggctacttttgagccagac
tgcatgtttggcaacgggaaaggatatcggggcaagaaggcgaccacggccgacggcacc
ccctgccaggggtgggctgcgcaggagccccacaggcacaacatcttcacgcccgagaca
aacccacgcgcaggtctggagcgcaattactgccgtaatcctgatggtgacaccaacggc
ccctggtgctacacgatgaacccaaggaagctttacgactactgtgacgtccctcagtgt
gcttcctcctcttcctatgactgtgggaagcccaaggtggagccgaagaagtgtccggga
agggtggtcggcgggtgtgtggccaacccacactcctggccttggcagatcagtctcagg
acacggactggacagcacttctgcggaggcactctcatagcccccgagtgggtgctgacc
gctgcccactgcctggaaaagtacccaaggccttcagcatacagagtcatcctgggcgca
cacaaagaagtgaatctggaattggacgttcaggacatagacgtggccaagttgttcttg
gagccctcgcgagcggacattgccctgatgaagctaagcagccccgccgtcatcaccgac
aaggtcatcccagcttgtctgccctcctcaaattacgtggttgccgaccggacggagtgc
tacatcactggctggggagaaacccaagggacctacggcgctggccttctcaaggaagcg
cagttgcctgtgattgagaacaaggtgtgcaatcgattcgagtacctgaacggaagagtc
aggtccacggagctgtgtgctgggcacctggcaggcggcacggacagctgccagggtgac
agcggtgggcctctggtttgctttgagaaagacaaatacatcctacaaggagtcacctcc
tggggtcttggctgtgcgcgtcccaataagcctggcgtctatgttcgtgtctcaaggttt
gttgattggattgaaagaacgatgagaaataattaa

DBGET integrated database retrieval system