KEGG   Oreochromis niloticus (Nile tilapia): 100703664
Entry
100703664         CDS       T06104                                 

Gene name
ikbkg
Definition
(RefSeq) NF-kappa-B essential modulator isoform X1
  KO
K07210  inhibitor of nuclear factor kappa-B kinase subunit gamma
Organism
onl  Oreochromis niloticus (Nile tilapia)
Pathway
onl04010  MAPK signaling pathway
onl04210  Apoptosis
onl04620  Toll-like receptor signaling pathway
onl04621  NOD-like receptor signaling pathway
onl04622  RIG-I-like receptor signaling pathway
onl04623  Cytosolic DNA-sensing pathway
onl04625  C-type lectin receptor signaling pathway
onl04920  Adipocytokine signaling pathway
onl05132  Salmonella infection
onl05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:onl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100703664 (ikbkg)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100703664 (ikbkg)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100703664 (ikbkg)
   04621 NOD-like receptor signaling pathway
    100703664 (ikbkg)
   04622 RIG-I-like receptor signaling pathway
    100703664 (ikbkg)
   04623 Cytosolic DNA-sensing pathway
    100703664 (ikbkg)
   04625 C-type lectin receptor signaling pathway
    100703664 (ikbkg)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    100703664 (ikbkg)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100703664 (ikbkg)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    100703664 (ikbkg)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:onl01001]
    100703664 (ikbkg)
Protein kinases [BR:onl01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   100703664 (ikbkg)
SSDB
Motif
Pfam: NEMO CC2-LZ zf_C2H2_10
Other DBs
NCBI-GeneID: 100703664
NCBI-ProteinID: XP_005462845
Ensembl: ENSONIG00000000520
UniProt: A0A669DN45
LinkDB
AA seq 621 aa
MVQPQPDGPMQWEMSGEESGATLRVPPELAANEVVTRLLSDNQQLREALRRSNLALRQRC
EEMEGWQRRTKEEREFLSCRFQEARSLVERLAQENHSLQSMVNGPGSSNTSSNHCCSSSQ
TEDPQLRPARNGPVDGPQTLDQREKKRVEDTEQCTQTSPPRSLDNTSAHSSLSYAQSSPP
ISFSDELGDILGNDNSQPVEGANEFLQLLKSHKEKLEEGMRELRRKNEELEKQRDEGEKE
KEQMLHCIDQLRGKLAQAQTNNVTEEVVQQRSEAQHSSDCSSLAKLTEQLQATQGRYREL
EEKLDYLQKSSAQRDRTEALLKQKDKDCAQLAKDCEALKAQATSLLGELQERQSWLDKSE
HERVLLEDKLSSKIKALQVAERELEQQKKQHHVAMDKLLLQTQSLEQALKSERHVVTEEK
KKLTQLQHAYTCLFRDYDSKLKNEGGDLCSRLEEAERALALKQDLIDKLKEEVEQQKGSL
ETIPVLTAQAEIYKADFLAEREAREKLNQKKEELQEQLNQALAENERLKQEATSRARMEQ
MKMRHLEDFSARPTRIPPPQGVFPPFNTVPPAPSFRTPGLGPVGDQGPVGTEELPDLCCP
KCQYLAPDMDTLQIHVMDCIQ
NT seq 1866 nt   +upstreamnt  +downstreamnt
atggtgcagccacaacccgatggccccatgcagtgggagatgtccggagaagagagtgga
gcgaccctcagggtcccaccagagcttgcagccaatgaagtggtgaccagattgttaagt
gacaaccagcagcttagagaggcactgcggcggagcaacctggccttgcgtcagcgctgt
gaggagatggagggatggcaacgaaggacaaaagaggaacgagagtttctcagctgtcgc
ttccaagaagcaaggtccctggtggagaggctggcccaggagaaccactccttacagagc
atggtgaacgggcctggctcctccaacacctcgtctaatcactgctgcagctccagccag
actgaagacccgcagctacgaccagccaggaatggaccggtggatggaccacagactcta
gatcagcgagaaaagaagagagtcgaagatacagagcaatgcacacagacatcaccacct
cgcagcctggataacacaagtgcgcatagctcattgagttacgcacaatcctctcccccc
atatcattttcagatgaactaggagatatattgggcaatgacaatagccagcctgtggaa
ggtgcaaacgagttcctgcagctgctgaagagccacaaagagaaactggaggaagggatg
cgagagctgagaaggaaaaatgaggagctagagaagcagagggacgagggagagaaagag
aaggagcaaatgcttcactgcatagaccagctccggggtaaactggcccaggcacagacg
aacaatgttactgaggaggttgtccagcagcgctctgaggcacagcactcgtccgactgc
tctagcctggctaagctcacagagcaacttcaggccacacagggcaggtatcgggagctg
gaggagaagcttgattatctgcagaagagctcagctcagagggacagaactgaagctctg
ctcaaacagaaggacaaggactgtgcccagctggccaaggactgcgaggccctgaaagct
caggcaacttccctgctaggagaactacaggaaagacagagctggttggataaaagtgag
catgaacgtgtactcctggaagacaaattaagcagtaaaataaaggccctccaggtggca
gagcgggagctggaacagcagaagaaacagcatcatgtggccatggacaagctgctgctg
caaacccagagcctggagcaggccctgaagtcagagagacatgttgtcactgaggagaag
aagaaactgacacagctacagcatgcatacacatgtctctttagagactatgattctaaa
ctgaagaatgagggtggagatctgtgcagccgactggaggaggctgagcgagcgctggcc
ctgaagcaggacctgattgataaactgaaggaagaggtggagcaacagaaaggctcccta
gaaacaattcctgtccttactgcacaggctgagatctacaaggcagatttccttgctgag
cgagaagccagagagaagttgaaccagaaaaaggaggagctgcaggagcagttgaaccag
gccttggctgagaatgagaggcttaaacaggaagctacctcacgtgcacgtatggaacaa
atgaagatgagacacctggaagacttctctgcacggcccacacgcattccccctccacaa
ggtgtgttcccccctttcaacacggtgccccccgctccctcattccgtactccgggattg
ggaccagtcggtgatcaaggtccagtcggaactgaggagctgccggatttatgttgtcct
aagtgccagtacctggccccagatatggacacactgcagatacatgtaatggactgtata
cagtaa

DBGET integrated database retrieval system