KEGG   Oreochromis niloticus (Nile tilapia): 100711294
Entry
100711294         CDS       T06104                                 

Gene name
cacna1c
Definition
(RefSeq) voltage-dependent L-type calcium channel subunit alpha-1C isoform X1
  KO
K04850  voltage-dependent calcium channel L type alpha-1C
Organism
onl  Oreochromis niloticus (Nile tilapia)
Pathway
onl04010  MAPK signaling pathway
onl04020  Calcium signaling pathway
onl04260  Cardiac muscle contraction
onl04261  Adrenergic signaling in cardiomyocytes
onl04270  Vascular smooth muscle contraction
onl04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:onl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100711294 (cacna1c)
   04020 Calcium signaling pathway
    100711294 (cacna1c)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    100711294 (cacna1c)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    100711294 (cacna1c)
   04261 Adrenergic signaling in cardiomyocytes
    100711294 (cacna1c)
   04270 Vascular smooth muscle contraction
    100711294 (cacna1c)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:onl04040]
    100711294 (cacna1c)
Ion channels [BR:onl04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   100711294 (cacna1c)
SSDB
Motif
Pfam: Ion_trans CAC1F_C GPHH Ca_chan_IQ PKD_channel
Other DBs
NCBI-GeneID: 100711294
NCBI-ProteinID: XP_025755436
Ensembl: ENSONIG00000011662
LinkDB
AA seq 2328 aa
MLRGLFERKPKHERLQEEPEVRFRGLLVTESVLGYRYIPPGGSDYSPPPPLPRPPPPGLT
NEHSGGTSHGDRGGGGGGVNHGVGVVGLAPEHIPTPGAALSWQAAIDAARQAKMMGNAAS
GGGAGLGSGGRGPISTASSTQRKRQHYTAKPKKQTTTTATRPPRALLCLTLKNPIRRACI
SIVEWKPFEIIILMTIFANCVALAVYIPFPEDDSNATNSNLERVEYLFLIIFTVEAFLKV
IAYGLLFHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKGDGATPIGGKAAGFDVKALRA
FRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFMGKMHKTC
VHNLTGTIAEEKPAPCAPDGAYGRHCTQNGTQCRVGWEGPNDGITNFDNFAFAMLTVFQC
ITMEGWTDVLYWMQDAMGYELPWVYFVSLVIFGSFFVLNLVLGVLSGEFSKEREKAKARG
DFQKLREKQQLEEDLKGYLDWITQAEDIDPENEEEGMDDEKPRNRELSMPASENESVNTD
NAPGGDVEGETCCTRLAIRISKSKFSRYSRRWNRLCRRKCRAAVKSQVFYWLVIFLVFLN
TLTISSEHHQQPQWLTDVQDIANKVLLALFTGEMLLKMYSLGLQAYFVSLFNRFDSFVVC
GGILETILVETKIMSPLGISVLRCVRLLRIFKITRYWNSLSNLVASLLNSVRSIASLLLL
LFLFIIIFSLLGMQLFGGKFNFDETRRSTFDNFPQSLLTVFQILTGEDWNSVMYDGIMAY
GGPAFPGMLVCIYFIILFICGNYILLNVFLAIAVDNLADAESLTSAQKEEEEEKERKKLA
RLGSPEKRHENEKPPLEEEKKEKIELKSITSDGETNTATKINMDDCCGDESEEKNPYPAN
DYIGDDDDDEPEMPVGPRPRPLSDIQLKEKAVPMPEARAFFIFSHTNKFRVLCHKVVNHN
IFTNLILFFILLSSISLAAEDPVKNDSFRNKILGYADHVFTGLFTIEIILKMTAYGAFLH
KGSFCRNYFNILDLVVVSVSLISSGIQSSAINVVKILRVLRVLRPLRAINRAKGLKHVVQ
CVFVAIRTIGNIVIVTTLLQFMFACIGVQLFKGKFFFCTDSSKQTQAECRGSFITYKDGD
VGKPDKAPRVWQNSDFNFDDVLQGMMALFAVSTFEGWPGLLYRAIDSHAEDVGPIYNYRV
VISIFFIIYIIIIAFFMMNIFVGFVIVTFQEQGEQEYKNCELDKNQRQCVEYALKARPLR
RYIPKNPYQYKVWYVVNSTYFEYLMFTLILLNTICLAMQHHGQTKNFNDAMNILNMLFTG
LFTVEMILKLIAFKPRGYFSDPWNVFDFLIVIGSIIDVILSEINPADSSSSSSSSSSSSS
SSSSSSHPPVVRPMGLQNSEENARISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQ
ALPYVALLIVMLFFIYAVIGMQMFGKIALRDHTQINRNNNFQTFPQAVLLLFRCATGEAW
QEIMLACKTNQPCEKGSTNESSLSNEDCGSHFAIIYFVSFYMLCAFLIINLFVAVIMDNF
DYLTRDWSILGPHHLDEFKRIWAEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKLCPHRVA
CKRLVSMNMPLNSDGTVMFNATLFALVRTALRIKTEGNLEQANEELRAIVKKIWKRTSMK
LLDQVVPPAGDDEVTVGKFYATFLIQEYFRKFKKRKEQGLVAKVPPKTALSLQAGLRTLH
DIGPEIRRAISGDLNVEEELDKGVKEPVSAASEDDIFRVKRTGGLFGNHVNYYNQSDGRG
SFPQSFTTQRPLHISQKGSPCEGESPSHEKLMDSTTFTPSSYSSSDSNANINNANNTGMA
GVATQGISRFPSPSISTVDGHTGQPLTPILLPRSAWCFPPKRTCFYDSLMRSDSCDSHLP
IIRRGEGSTEETYDESYVEDRVYHEDDHSLSSDMLVYHDETCKQLTPMEEAEEVEDRRGG
GGGWQSPRRVFLCPTSLGRRSSFHLECLRRQSRPDVSQKTAVPLHLVHHQALAVAGLSPL
LRRSHSPTLFSRLCSTPPASPTAQCSDASYQRVPSLRLEGSNSHEKLNTSLPSVNCGPWY
NDSNGNSPVPSPSPTPSMPASSQRAPRPVSLTVPSLLGKDSSSLSHGSAGSLVEAVLISE
GLGHFAQDPSFIEATKAELADACDMTIEEMEHAANNILNGNSPTNATSSTSSTSQHSPNG
NVLPFHTTAAAAAASTHRDRVVGLSPGEGGGEATGSRGSIHGPSSIEERQELLARERGQE
EEEEEEEEEEEAGGREEGHYRGSLVIGGARQRNSGLLEDEDMECVTSL
NT seq 6987 nt   +upstreamnt  +downstreamnt
atgctgagaggcctgtttgagaggaaacctaaacatgagaggctgcaggaggaacctgaa
gtcagatttagaggattgctggtgacagagagtgtcctgggatatcgatacatcccacct
ggaggctccgactactctccccctccccctcttcctcgacctcctccacctggcctgacc
aatgagcacagtggtggcactagccatggcgaccgtggtggaggagggggtggtgtcaac
catggagtgggcgtggttggtctggctccagagcacatccccacaccgggggcagccctg
agctggcaggcggcgatcgatgccgcgcggcaggcgaagatgatgggtaatgccgcatcg
ggtggaggggcggggcttgggtccggagggcgagggcccatctccactgccagctccacg
caacggaagagacagcactataccgccaaacccaagaaacaaaccacaacgacagccaca
aggccgccacgggctctactctgcctcacactcaagaatcctatccgcagggcctgcatc
agcatcgtagagtggaaaccatttgagatcattatcctgatgacaatttttgccaactgt
gtggccttagctgtctacatcccctttcccgaggatgactcgaacgccaccaactccaac
ttggagcgtgtggagtatctgttcctcatcattttcacggtggaggcgttcctgaaggta
atagcctacggcctgctcttccaccccaacgcctacctgaggaacggctggaatctgcta
gacttcatcattgtagttgtagggttattcagtgcaatcttggagcaggccacaaaaggg
gacggggctactcctattggagggaaagcagcgggctttgatgtcaaggctctgagggca
ttcagagtactcagacccctcagactggtctctggagtaccgagtttacaggtagtgttg
aactccataatcaaagccatggttcctctgctccatatcgccctgctggtcctcttcgtc
atcatcatctatgccatcatcggtctggagctcttcatgggcaagatgcacaagacctgc
gttcataacctaacaggcactatcgcagaggaaaagccagcaccgtgtgcacctgatgga
gcttatggtcgacattgcacgcagaatggaacacagtgcagagtggggtgggagggccca
aacgacggcatcacaaacttcgacaactttgcctttgccatgttaacggtgttccagtgt
ataaccatggaaggctggacggacgtgctgtactggatgcaggatgctatgggctatgag
ctgccatgggtctattttgtctctcttgtcatcttcggctcttttttcgttctcaatctc
gttctgggagtgttgagcggagagttttccaaggagagagagaaggccaaggcacgcggt
gacttccagaaactcagagaaaaacagcaactggaggaagacctcaagggctatttagac
tggatcactcaagctgaagacattgacccagagaatgaagaggagggcatggacgatgag
aaacccagaaatcgtgagttgagcatgccagccagcgagaatgaatcagtcaacacagac
aatgcccccgggggagacgtagagggtgagacctgctgtacccgcctggcaattaggatc
tccaaatccaagttcagccgctactcccggaggtggaacaggctgtgtcgaaggaaatgc
cgggcagcagtcaaatcacaagttttctattggctggtcattttcctggttttcctcaac
actctgaccatttcctctgaacatcaccagcagcctcagtggctaactgatgtacaagac
atagccaataaggttttgctagcactctttactggtgagatgctgttgaagatgtacagt
ctgggcctgcaggcctactttgtttcactcttcaatcggttcgacagcttcgtagtatgc
ggagggatccttgaaaccattctggtggaaacaaaaatcatgtctcctcttggcatctct
gtgttacgttgtgtacgcttactccgaatcttcaaaataaccagatattggaactctttg
tccaacctggtggcatccctgctgaactctgtccgctccatcgcttccctgctgctcctg
ctcttcctcttcatcatcatcttctccctgctgggcatgcagctgtttgggggaaaattc
aactttgacgagacccgacgaagcacgtttgacaacttcccccagtctctgctcactgtg
tttcagatcctgaccggagaggactggaactctgtgatgtatgatggtatcatggcgtac
ggtggtccagcttttcctggcatgctagtttgcatctacttcatcatcctcttcatctgt
ggaaactatatcctgctgaatgtcttcttggccattgctgtagacaatctggcagacgcc
gagagcttgacatcagcccagaaagaggaagaggaggagaaggagaggaaaaaactggcc
aggcttggcagtccagagaagcgtcatgaaaatgagaagccgcctctggaggaagagaag
aaggagaaaatagagctgaagtccattacttctgatggggagaccaacactgctacaaag
attaacatggatgactgctgtggggatgagagcgaagagaagaatccatatcccgccaat
gattatataggagatgacgacgacgatgagccagagatgcctgtgggcccgaggccacgg
cccctctctgacattcagctgaaggaaaaggctgtccccatgcctgaggcccgagctttc
tttatcttcagccacaccaacaagttcagggttctctgccataaggtcgtcaaccacaac
atcttcaccaacctcatcctcttcttcatcctgctcagcagcatcagtctagcggcagaa
gaccctgtcaaaaatgactccttcagaaataagatcctgggctatgcagatcatgtgttt
actggactcttcaccattgagatcattcttaagatgacagcctatggcgccttcctccac
aaaggttctttctgtagaaactattttaacatcctggacttggtggtggtcagcgtgtcc
ctcatctcctctggaatacagtccagcgcaattaatgttgtaaaaatcctgagagttctg
cgagtgcttagaccactgagggccatcaacagagccaaaggactaaagcatgtagtgcag
tgcgtgtttgtggccatcaggactattggcaacatcgtcatcgtcaccacgttactccag
ttcatgttcgcctgtattggagtgcaactctttaagggaaagttcttcttctgtaccgac
agctctaagcagactcaggcagagtgcagaggttctttcatcacgtataaagacggggat
gtggggaagcctgacaaagccccaagagtgtggcagaacagtgactttaacttcgatgat
gttctacaaggcatgatggcgctgtttgccgtgtctaccttcgagggatggccagggtta
ctgtaccgagccattgactctcatgctgaggatgtggggcccatttacaactaccgcgtg
gtcatttccatcttctttatcatctacatcatcatcattgccttcttcatgatgaacatt
ttcgtcggtttcgtcatcgtcacattccaggaacaaggggagcaggaatataagaactgc
gagctggacaaaaaccagcgtcagtgcgtggagtacgctctaaaggctcgtccgctgcgt
cgctacatcccaaagaacccttaccagtacaaggtgtggtatgtggtcaactccacctac
tttgagtatttgatgttcacactcatccttctcaacaccatctgtctggccatgcagcat
catggacagaccaaaaatttcaatgatgccatgaacatcctcaacatgctcttcacagga
cttttcactgttgagatgatccttaaactgatcgccttcaaacccagggggtactttagt
gatccctggaatgtgtttgatttcctcatcgtaattggcagcataatagacgtcattctc
agtgaaatcaacccggctgactcctcctcgtcctcgtcctcgtcctcttcgtcctcctct
tcctcctcttcctcctctcacccccctgtggtaaggccaatgggactgcagaactctgaa
gagaacgccaggatctccatcaccttcttccggctgttccgcgtgatgaggctggtgaag
ctgctgtctcgcggggaagggattcggaccctgctgtggaccttcatcaaatccttccaa
gctctgccctacgtagctctgcttatagtgatgctgttcttcatatacgccgtcattggc
atgcagatgtttggtaagatagctctgcgggaccacacgcaaatcaacaggaacaacaat
ttccagacattccctcaggcggtgctgctgctcttcagatgtgcaacaggtgaggcgtgg
caggagatcatgctggcgtgtaagaccaatcagccatgtgagaaaggatcaaccaatgaa
agcagcttgtccaatgaggactgcggcagccattttgccatcatttattttgtcagcttc
tacatgctctgtgccttcctgatcatcaacttgtttgtggccgtcatcatggacaacttt
gactacctgacgcgtgactggtcgatcctggggccacatcatcttgacgagttcaagagg
atctgggctgaatacgacccagaagctaaggggagaataaaacatcttgatgtggtgact
ctgctcagaagaatccagcctcccctcgggtttggaaagctctgtccacacagggtggct
tgcaagcgtctggtgtcgatgaacatgcctctgaacagcgatggaacagtgatgttcaac
gccacactgtttgctctggtcagaaccgcactcaggataaagacagaagggaacttggag
caggccaatgaggaactgagggcaatagtgaagaagatatggaagagaaccagtatgaag
ctcttggatcaagtagtgccccctgctggtgatgacgaggtaacagtcgggaaattctac
gccaccttcctcatccaggaatatttccgcaagtttaagaaaaggaaagaacaagggctg
gtggccaaggtgccccccaaaactgcactctctctgcaggcgggcctgcggacattgcac
gacatcggtccggagattaggagagccatctccggagacctaaatgtggaggaggagctg
gataaaggcgtaaaggagcctgtgtcagcggcgtctgaggacgatatcttcagggtaaag
cgcacaggagggttgtttggcaaccatgtcaactactacaaccagagcgatggccgtggg
tccttcccgcagtctttcactacccagcgtcccttgcacatcagccaaaaagggtcacct
tgtgaaggcgagagcccgtctcatgagaagctcatggattcaactactttcaccccttcc
tcttactcctcatcagactctaacgccaacatcaacaatgccaacaacacaggcatggcc
ggggtggcaacccagggcatcagccgattcccgagcccatctataagcactgtggatggg
cacaccgggcagccactcacccccatcctgctgccaagatccgcgtggtgctttcctcca
aagaggacgtgtttttatgacagcctcatgcgctcagactcgtgtgacagtcatctgcca
atcatccgaagaggggaggggtcaacagaggagacatacgacgagagctatgttgaagac
agggtgtaccatgaggatgaccactcgctctcgtctgacatgctggtgtatcacgatgag
acttgtaagcagttgactcccatggaggaagcagaggaagtcgaggacagaagaggagga
ggaggagggtggcagtctcctaggagagtcttcctctgtcccacttctctggggcggaga
tcatccttccatctggagtgtctccggagacagtcgaggccagacgtctctcagaagacg
gctgtacctttacatcttgtacatcatcaggctctggctgtagcagggttgagtcctctg
ctaagacggagtcactcaccgaccctcttcagtcggctgtgctccacacctccagcaagt
cccacagctcaatgcagtgatgcctcctaccagcgagttccctctctgaggctagagggc
tccaactcccatgaaaagctcaataccagcttaccctctgtcaactgtggcccatggtac
aatgacagtaatgggaatagcccggtgcccagtcctagccccacccctagcatgccagcg
tccagtcaaagggcaccgaggccagtgtcgctcactgtgccgtctctgttggggaaagac
tccagctcgctgtctcacggcagcgcaggcagtctagtggaggcggtcctaatatcagag
ggcttgggtcattttgcccaggacccctcgttcattgaggcaaccaaagcggagctggct
gatgcctgcgacatgaccatcgaggagatggagcacgccgccaacaacattctcaacggc
aactcgcccacaaacgccacatccagcacctcctccacctctcagcacagccctaacggc
aacgtcctccccttccacacaacagcagcagcagcagcagcatcaacgcacagggaccga
gtggtcggcttgagtcctggtgaaggtgggggagaagccacaggaagcagaggctccata
cacggtccctcctctatagaggagcggcaggagctgctagccagagagagaggacaagaa
gaagaggaggaggaagaagaggaggaggaggaggcaggagggagggaagaggggcactac
agaggctcgcttgtgatcggaggagcacgacagaggaacagcgggctgttggaggacgag
gatatggagtgtgtgacaagcttatag

DBGET integrated database retrieval system