KEGG   Orcinus orca (killer whale): 101275264Help
Entry
101275264         CDS       T05247                                 

Gene name
PARK7
Definition
(RefSeq) protein deglycase DJ-1 isoform X2
  KO
K05687  protein DJ-1 [EC:3.5.1.124]
Organism
oor  Orcinus orca (killer whale)
Pathway
oor05012  Parkinson disease
Brite
KEGG Orthology (KO) [BR:oor00001]
 09160 Human Diseases
  09164 Neurodegenerative diseases
   05012 Parkinson disease
    101275264 (PARK7)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:oor01002]
    101275264 (PARK7)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:oor04147]
    101275264 (PARK7)
Enzymes [BR:oor01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.124  protein deglycase
     101275264 (PARK7)
Peptidases [BR:oor01002]
 Cysteine Peptidases
  Family C56: PfpI endopeptidase family
   101275264 (PARK7)
Exosome [BR:oor04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101275264 (PARK7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DJ-1_PfpI ThiJ_like GATase_3
Motif
Other DBs
NCBI-GeneID: 101275264
NCBI-ProteinID: XP_004272399
LinkDB All DBs
Position
Unknown
AA seq 189 aa AA seqDB search
MASKRALVILATGAEEMETVIPVDVMRRAGIKVTIAGLTGKDPVQCSRDVVICPDASLED
AKKQGPYDVVVMPGGGLGAQNLCQSSAVKEILKEQEKRKGLIAAICAGPTALLAHEIGFG
SKVTTHPLAKDKMMDGNHYSYSENRVERDGLIVTSRGPGTSFEFALAIVEALAGKEVAEQ
VKAPLVLKD
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atggcttcaaaaagagctctggtcatcctggctacaggagcagaggagatggagacggtc
atccctgtcgatgtcatgagacgagctggaattaaggtcaccattgcaggtctgactgga
aaagacccggtacagtgtagccgagatgttgtcatttgtcctgatgccagtctagaagat
gcaaaaaaacagggaccttacgatgtggtggttatgccaggaggtggtctgggcgcacag
aatttatgccagtcctctgctgtgaaggagatactgaaggaacaagaaaagaggaagggc
ctcatcgccgcaatctgtgcgggacctacggctctgttggctcatgaaataggttttgga
agcaaagttacaacacacccacttgctaaagacaaaatgatggacggaaatcattacagc
tactcagagaaccgcgtggaaagggacggcctgatcgtcaccagccgggggccgggaacc
agcttcgagtttgccctggcgatcgtcgaggcgctggccggcaaggaggtggccgaacaa
gtgaaggccccgctggttcttaaagattag

DBGET integrated database retrieval system