KEGG   Odobenus rosmarus divergens (Pacific walrus): 101362427
Entry
101362427         CDS       T05148                                 

Gene name
TP53
Definition
(RefSeq) cellular tumor antigen p53
  KO
K04451  tumor protein p53
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro01522  Endocrine resistance
oro01524  Platinum drug resistance
oro04010  MAPK signaling pathway
oro04071  Sphingolipid signaling pathway
oro04110  Cell cycle
oro04115  p53 signaling pathway
oro04137  Mitophagy - animal
oro04151  PI3K-Akt signaling pathway
oro04210  Apoptosis
oro04211  Longevity regulating pathway
oro04216  Ferroptosis
oro04218  Cellular senescence
oro04310  Wnt signaling pathway
oro04722  Neurotrophin signaling pathway
oro04919  Thyroid hormone signaling pathway
oro05012  Parkinson disease
oro05014  Amyotrophic lateral sclerosis
oro05016  Huntington disease
oro05160  Hepatitis C
oro05161  Hepatitis B
oro05162  Measles
oro05163  Human cytomegalovirus infection
oro05165  Human papillomavirus infection
oro05166  Human T-cell leukemia virus 1 infection
oro05167  Kaposi sarcoma-associated herpesvirus infection
oro05168  Herpes simplex virus 1 infection
oro05169  Epstein-Barr virus infection
oro05200  Pathways in cancer
oro05202  Transcriptional misregulation in cancer
oro05203  Viral carcinogenesis
oro05205  Proteoglycans in cancer
oro05206  MicroRNAs in cancer
oro05210  Colorectal cancer
oro05212  Pancreatic cancer
oro05213  Endometrial cancer
oro05214  Glioma
oro05215  Prostate cancer
oro05216  Thyroid cancer
oro05217  Basal cell carcinoma
oro05218  Melanoma
oro05219  Bladder cancer
oro05220  Chronic myeloid leukemia
oro05222  Small cell lung cancer
oro05223  Non-small cell lung cancer
oro05224  Breast cancer
oro05225  Hepatocellular carcinoma
oro05226  Gastric cancer
oro05230  Central carbon metabolism in cancer
oro05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:oro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101362427 (TP53)
   04310 Wnt signaling pathway
    101362427 (TP53)
   04071 Sphingolipid signaling pathway
    101362427 (TP53)
   04151 PI3K-Akt signaling pathway
    101362427 (TP53)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    101362427 (TP53)
  09143 Cell growth and death
   04110 Cell cycle
    101362427 (TP53)
   04210 Apoptosis
    101362427 (TP53)
   04216 Ferroptosis
    101362427 (TP53)
   04115 p53 signaling pathway
    101362427 (TP53)
   04218 Cellular senescence
    101362427 (TP53)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    101362427 (TP53)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    101362427 (TP53)
  09149 Aging
   04211 Longevity regulating pathway
    101362427 (TP53)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101362427 (TP53)
   05202 Transcriptional misregulation in cancer
    101362427 (TP53)
   05206 MicroRNAs in cancer
    101362427 (TP53)
   05205 Proteoglycans in cancer
    101362427 (TP53)
   05203 Viral carcinogenesis
    101362427 (TP53)
   05230 Central carbon metabolism in cancer
    101362427 (TP53)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101362427 (TP53)
   05212 Pancreatic cancer
    101362427 (TP53)
   05225 Hepatocellular carcinoma
    101362427 (TP53)
   05226 Gastric cancer
    101362427 (TP53)
   05214 Glioma
    101362427 (TP53)
   05216 Thyroid cancer
    101362427 (TP53)
   05220 Chronic myeloid leukemia
    101362427 (TP53)
   05217 Basal cell carcinoma
    101362427 (TP53)
   05218 Melanoma
    101362427 (TP53)
   05219 Bladder cancer
    101362427 (TP53)
   05215 Prostate cancer
    101362427 (TP53)
   05213 Endometrial cancer
    101362427 (TP53)
   05224 Breast cancer
    101362427 (TP53)
   05222 Small cell lung cancer
    101362427 (TP53)
   05223 Non-small cell lung cancer
    101362427 (TP53)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    101362427 (TP53)
   05014 Amyotrophic lateral sclerosis
    101362427 (TP53)
   05016 Huntington disease
    101362427 (TP53)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101362427 (TP53)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101362427 (TP53)
   05161 Hepatitis B
    101362427 (TP53)
   05160 Hepatitis C
    101362427 (TP53)
   05162 Measles
    101362427 (TP53)
   05168 Herpes simplex virus 1 infection
    101362427 (TP53)
   05163 Human cytomegalovirus infection
    101362427 (TP53)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101362427 (TP53)
   05169 Epstein-Barr virus infection
    101362427 (TP53)
   05165 Human papillomavirus infection
    101362427 (TP53)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    101362427 (TP53)
   01522 Endocrine resistance
    101362427 (TP53)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:oro03000]
    101362427 (TP53)
   03036 Chromosome and associated proteins [BR:oro03036]
    101362427 (TP53)
   03400 DNA repair and recombination proteins [BR:oro03400]
    101362427 (TP53)
Transcription factors [BR:oro03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   p53
    101362427 (TP53)
Chromosome and associated proteins [BR:oro03036]
 Eukaryotic type
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     101362427 (TP53)
DNA repair and recombination proteins [BR:oro03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    101362427 (TP53)
SSDB
Motif
Pfam: P53 P53_tetramer P53_TAD
Other DBs
NCBI-GeneID: 101362427
NCBI-ProteinID: XP_004398548
UniProt: A0A2U3VT95
LinkDB
Position
Unknown
AA seq 381 aa
MQDPQSELTIDPPLSQETFSELWNLLPENNVLSPELSPAVDELLLSEGVANWLDAGSDDA
PRMPAAPAPAGPGPTTSWPLSSFVPSPKTYPGTYGFRLGFLHSGTAKSVTCTYSPSLNKL
FCQLAKTCPVQLWVSSPPPPDTCVRAMAIYKKSEFVTEVVRRCPHHERCPDNSDGLAPPQ
HLIRVEGNLRAKYLDDRNTFRHSVVVPYEPPEVGSDCTTVHYNYMCNSSCMGGMNRRPIL
TIITLEDSSGTVLGRSSFEVRVCACPGRDRRTEEENFRKKGEPCPEPPPGSTKRALTPST
SSSPPQKKKPLDGEYFTLQIRGRERFNMFRELNEALELKDALSGKEPGGSRAHSSHLKAK
KGQSTSRHKKLMLKREGPDSD
NT seq 1146 nt   +upstreamnt  +downstreamnt
atgcaggacccacagtcagagctcaccattgacccccctctgagccaggagacattttcc
gaattgtggaacctgcttcctgaaaacaatgttctgtctcccgagctgtccccagcagtg
gacgaactgctgctctcagaaggcgtcgcgaactggctggatgcagggtccgatgacgct
cccaggatgcccgcagctcctgcccccgcgggcccgggaccaaccacctcctggcccctg
tcatcctttgtcccttccccgaagacctaccctggcacctatgggttccgtttggggttc
ctgcattccgggacagccaagtccgttacttgcacgtactccccgtccctcaacaagctg
ttttgccagctggcaaagacctgcccggtgcagctgtgggtcagctccccgcccccaccc
gacacctgcgtccgcgccatggccatttataagaagtccgagttcgtgacagaggttgtg
cggcgctgcccccaccacgagcgctgcccggacaacagcgatgggctggccccgcctcag
catctcatccgggtggaaggaaacttgcgtgccaagtacttggacgacagaaacactttc
cgacacagcgtggtggtgccctacgagccgcccgaggtcggctctgattgtaccaccgtc
cactataactacatgtgtaacagctcctgcatggggggcatgaaccggcggcccatcctc
accatcatcaccctggaagactccagtggtactgtgctgggacggagcagctttgaggta
cgcgtttgtgcctgtcctgggagagaccggcgcacagaagaggagaatttccgcaagaag
ggggagccttgccccgagccgccccccgggagcactaagcgagcactgactcccagcacc
agctcctctcctccccaaaagaagaagccactggatggggaatatttcacccttcagatc
cgtgggcgcgaacgcttcaatatgttcagggagttgaatgaggccttggagctgaaggat
gccctgagtggaaaggagccagggggaagcagggctcactccagccacctgaaggctaag
aaggggcagtctacctcccgccataaaaaactgatgttgaagagagagggacccgactca
gactga

DBGET integrated database retrieval system