KEGG   Odobenus rosmarus divergens (Pacific walrus): 101370279
Entry
101370279         CDS       T05148                                 

Gene name
CD4
Definition
(RefSeq) T-cell surface glycoprotein CD4
  KO
K06454  T-cell surface glycoprotein CD4
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro04060  Cytokine-cytokine receptor interaction
oro04514  Cell adhesion molecules
oro04612  Antigen processing and presentation
oro04640  Hematopoietic cell lineage
oro04658  Th1 and Th2 cell differentiation
oro04659  Th17 cell differentiation
oro04660  T cell receptor signaling pathway
oro05135  Yersinia infection
oro05166  Human T-cell leukemia virus 1 infection
oro05170  Human immunodeficiency virus 1 infection
oro05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
oro05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:oro00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101370279 (CD4)
   04514 Cell adhesion molecules
    101370279 (CD4)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101370279 (CD4)
   04612 Antigen processing and presentation
    101370279 (CD4)
   04660 T cell receptor signaling pathway
    101370279 (CD4)
   04658 Th1 and Th2 cell differentiation
    101370279 (CD4)
   04659 Th17 cell differentiation
    101370279 (CD4)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101370279 (CD4)
  09163 Immune disease
   05340 Primary immunodeficiency
    101370279 (CD4)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    101370279 (CD4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101370279 (CD4)
   05170 Human immunodeficiency virus 1 infection
    101370279 (CD4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:oro04090]
    101370279 (CD4)
CD molecules [BR:oro04090]
 Proteins
  101370279 (CD4)
SSDB
Motif
Pfam: CD4-extracel C2-set ig Ig_3 V-set Ig_2 I-set Tcell_CD4_C Ig_6 Herpes_gE Receptor_2B4 Pilin
Other DBs
NCBI-GeneID: 101370279
NCBI-ProteinID: XP_004413972
UniProt: A0A2U3WWZ7
LinkDB
Position
Unknown
AA seq 462 aa
MSRGAAFRHLLLVLQLAMLPAVPQEREVVLAKVGDTAELPCHATPGKNIGFNWKHSSMVK
ILGRQGSFWLTGASKLKHRVESKKNLWDQGSFPLIIKDLEAADSGVYFCEVEGKKQEVEL
LVFDLTAKWDTGSGGGSNIRLLQGQQLTLTVEGPSGSSPSVQWKGPGNKSKSSGQSLSLS
GVEPQESGTWTCTISQNQKTVVFNINILVLAFQKVSNTVYTKEGEQVEFSFPLNFEDENL
SGELRWQAEGTPSSRLWISFVLENGKLSLKDTHHARLQMKGFPPLSFILPQALSQYAGSG
NLTLSLAKGTLQREVNLVVMRVTKSQNNLTCEVLGPTSPELTLSLNLEERAAKFSKQQKL
VSVVDPERGTWQCLLSDKDKVLLASKVEVLSPVLTKAWPKLLAIVLGGILGLLLFIGLCI
FCCVKCWHRRRQAERMSQIKRLLSENKTCQCSHRLQKTCNLI
NT seq 1389 nt   +upstreamnt  +downstreamnt
atgagtcgaggggctgcttttaggcacctgctcctggtgctgcagttggcgatgctcccc
gcggtccctcaggaaagagaggtggtgttggcgaaggtgggagacacagcggaactgccc
tgccatgctaccccggggaagaacataggcttcaactggaaacattcttccatggtcaag
attctggggcgtcagggctccttctggcttacaggtgcctccaagctgaagcaccgcgtc
gaatcgaaaaaaaacctgtgggaccaaggatcctttcctctgatcatcaaggatcttgaa
gcagcagactcaggggtttacttctgtgaggtagagggcaagaagcaagaggtggagttg
ctggtgttcgacttgactgccaagtgggacaccggcagtggcggcggcagcaacatccgc
ctcctgcaagggcagcagctgaccctgaccgtggagggcccctctggtagtagcccttcc
gtgcaatggaaaggtccagggaataaaagcaagagcagtggccagagcctctcactgtct
ggggtggagccgcaggagagcggtacctggacatgcaccatctcccagaaccagaagaca
gtggtgttcaacataaacatcttggtgctggctttccagaaggtctctaacacagtctat
acaaaagaaggggagcaggtggagttctccttcccgcttaacttcgaagatgaaaacctg
agcggggagctgaggtggcaggcagaggggactccctcttcccggctctggatctccttc
gtcttggagaacgggaagctatcgttgaaagatactcaccacgccagactccagatgaag
ggttttcccccgctcagctttatcctgccccaggctttgtctcagtatgctggttctgga
aacctgaccctgagtcttgccaagggaacattgcagcgggaagtgaatctcgtggtgatg
agagtgactaagtctcagaacaatttgacctgcgaggtgctaggacccacctcccctgag
ctgactctgagcttgaatctggaagagcgggctgccaaattctcgaagcagcagaagctg
gtatctgtggtggaccctgagaggggaacatggcagtgtctactgagtgacaaggacaaa
gtcctgctagcctccaaggtcgaggttttgtccccagtgctcaccaaggcctggccaaag
ctcttggccattgtgctgggcgggatcttaggccttctgcttttcattgggctctgcatc
ttctgctgtgttaaatgctggcaccgcaggcgccaggcagagcggatgtctcagatcaag
agactcctcagtgagaacaagacctgccagtgctcccacaggctccagaagacatgcaat
ctcatttga

DBGET integrated database retrieval system