KEGG   Odobenus rosmarus divergens (Pacific walrus): 101385299
Entry
101385299         CDS       T05148                                 

Gene name
IL7R
Definition
(RefSeq) interleukin-7 receptor subunit alpha
  KO
K05072  interleukin 7 receptor
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro04060  Cytokine-cytokine receptor interaction
oro04068  FoxO signaling pathway
oro04151  PI3K-Akt signaling pathway
oro04630  JAK-STAT signaling pathway
oro04640  Hematopoietic cell lineage
oro05200  Pathways in cancer
oro05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:oro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101385299 (IL7R)
   04068 FoxO signaling pathway
    101385299 (IL7R)
   04151 PI3K-Akt signaling pathway
    101385299 (IL7R)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101385299 (IL7R)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101385299 (IL7R)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101385299 (IL7R)
  09163 Immune disease
   05340 Primary immunodeficiency
    101385299 (IL7R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:oro04050]
    101385299 (IL7R)
   04090 CD molecules [BR:oro04090]
    101385299 (IL7R)
Cytokine receptors [BR:oro04050]
 Interleukin receptor families
  IL2 receptor family
   101385299 (IL7R)
CD molecules [BR:oro04090]
 Proteins
  101385299 (IL7R)
SSDB
Motif
Pfam: FN3_7 fn3 Pur_ac_phosph_N
Other DBs
NCBI-GeneID: 101385299
NCBI-ProteinID: XP_004404008
UniProt: A0A2U3W724
LinkDB
Position
Unknown
AA seq 458 aa
MTILGTAFGMVFYLLQAVSGESGYAQNGEFEDAELDDYSFSCYSQLEVDGTQHLLTCAFD
DPDVNSTNLEFEICGALLNVKCLTFDKLQEMYFIKTKKFLLIGDSEIHVKLGGKNITSKK
LNIVEIVKPEAPFDIRVIYRKGANDFLVTFNTSHSQKKYVKELMHEVAYRQEKNENDWMH
VNLSSTKLTLLQRKLQPDAMYEIKVRSIPNANYFQGFWSEWSPTFHFRTPEITGGKMDPV
LLTISILSFFSVALMVILACALWKKRIKPIVWPSLPDHKKTLEQLCKKPKKNLNVSFNPE
SFLDCQIHKVDGIQARDEAESFLQDTSPSQLDESEKRRLGGGMQGPTWPSEHAAITPKAF
RGDSPFGCLAGSISMCEALVQPSSRSPDCGESGKNGPHVYQGLLLGPGTTNSTVPTPSPF
QSGILTLNPTAQGQPVLTSLGSSQEEAYVTMSSFYQNQ
NT seq 1377 nt   +upstreamnt  +downstreamnt
atgacgattctgggtacagcttttggtatggttttctatttacttcaagccgtttctgga
gaaagtggctatgcacagaacggagagtttgaagatgctgagctggatgactattcattc
tcttgctacagtcagttggaagtggatggaacccagcacttgctgacttgtgcttttgat
gacccggatgtcaacagcaccaatctggaatttgaaatatgtggggcccttttgaatgta
aaatgcctgacttttgataaactgcaagagatgtatttcattaagacaaagaaattctta
ctcattggagacagcgaaatacacgtgaagcttggaggaaagaacataacttccaagaaa
ttgaacatagttgagatagttaaacccgaggctccttttgacataagagtcatctatcgc
aaaggagcaaatgactttctggtgacatttaacacatctcactcacaaaagaagtatgtg
aaagaattaatgcatgaggtagcctatcgccaggaaaaaaatgaaaatgactggatgcat
gtgaacttatccagtacaaagctgacccttctacagagaaagctacaacctgatgcaatg
tatgagattaaagtccggtccatccctaatgccaactattttcaaggcttctggagtgaa
tggagtccaaccttccacttcagaactccggagatcacaggtgggaagatggatcctgtt
ttactaactattagcattctgagtttcttctctgtggctctgatggtcatcttggcctgt
gcgttatggaaaaaaagaattaaacctattgtgtggcccagcctccctgatcataagaag
actctggaacaactgtgcaagaaacccaaaaagaatttgaatgtgagtttcaatcctgaa
agcttcctggactgccagattcataaggtggatggcattcaagctagagatgaagcagaa
agctttctgcaagacacttctccttcacaactagacgagtctgagaagcggaggcttgga
gggggtatgcagggccccacctggccatcagagcatgcagccatcaccccaaaagctttc
agaggagattcacccttcggatgcctggctgggagcatcagtatgtgtgaggcccttgtg
caaccctcttctaggtccccagactgcggggaaagcggcaagaatgggcctcatgtgtac
cagggcctgctgcttggcccaggaactacaaatagcactgtgcccactccatctcctttc
cagtcaggaattctgacactgaacccaacggcccagggacagcccgtgctcacttccttg
ggatcaagtcaggaagaagcatatgtcactatgtccagcttctaccaaaaccaatga

DBGET integrated database retrieval system