KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4344210Help
Entry
4344210           CDS       T01015                                 

Definition
(RefSeq) superoxide dismutase [Cu-Zn] 2
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    4344210
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     4344210
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 4344210
NCBI-ProteinID: XP_015647771
UniProt: P28757
LinkDB All DBs
Position
7
AA seq 152 aa AA seqDB search
MVKAVAVLASSEGVKGTIFFSQEGDGPTSVTGSVSGLKPGLHGFHVHALGDTTNGCMSTG
PHFNPTGKEHGAPQDENRHAGDLGNITAGADGVANVNVSDSQIPLTGAHSIIGRAVVVHA
DPDDLGKGGHELSKTTGNAGGRVACGIIGLQG
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atggtgaaggctgttgctgtgcttgctagcagtgagggtgtcaagggcaccatctttttc
tcccaagagggagatggtccgacctctgtgacgggaagtgtctctgggctcaagccaggg
ctccatggattccatgtgcacgcgctcggtgacaccactaatggctgcatgtcaactgga
ccacacttcaatcctactgggaaggaacatggggcaccacaagatgagaaccgccatgcc
ggtgatcttggaaatataacagctggagcagatggtgttgctaatgtcaatgtctctgac
agccagatcccccttactggagcacactccatcattggccgagctgttgttgtccatgct
gatcctgatgatcttggcaagggtggacatgagcttagcaagaccactggaaatgctggg
ggccgagttgcttgcggaatcatcggactccagggttag

DBGET integrated database retrieval system