KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112262208
Entry
112262208         CDS       T05605                                 

Gene name
mdm2
Definition
(RefSeq) LOW QUALITY PROTEIN: E3 ubiquitin-protein ligase Mdm2
  KO
K06643  E3 ubiquitin-protein ligase Mdm2 [EC:2.3.2.27]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
otw04110  Cell cycle
otw04115  p53 signaling pathway
otw04120  Ubiquitin mediated proteolysis
otw04144  Endocytosis
otw04218  Cellular senescence
otw04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    112262208 (mdm2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    112262208 (mdm2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    112262208 (mdm2)
  09143 Cell growth and death
   04110 Cell cycle
    112262208 (mdm2)
   04115 p53 signaling pathway
    112262208 (mdm2)
   04218 Cellular senescence
    112262208 (mdm2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    112262208 (mdm2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:otw04131]
    112262208 (mdm2)
   04121 Ubiquitin system [BR:otw04121]
    112262208 (mdm2)
Enzymes [BR:otw01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     112262208 (mdm2)
Membrane trafficking [BR:otw04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    112262208 (mdm2)
Ubiquitin system [BR:otw04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   MDM2/MDM4 proteins
    112262208 (mdm2)
SSDB
Motif
Pfam: zf-C3HC4_3 SWIB zf-RanBP FAM117 zf-RING_2 DZR
Other DBs
NCBI-GeneID: 112262208
NCBI-ProteinID: XP_024293678
LinkDB
Position
11
AA seq 454 aa
MAENCERMSEWHRSSSQINTLDNEKLVRPKEKLRVLLQQAGADKDVFTMKEVIFYXGQYI
MKKQLYDMKQQHIVHCAXDPLGAVLGVDSFSVKNHGEDTHCTVWTSSPSKSPRTHTITHT
AWDGQSHLSSRNPGARVNRIEGLRGDVVDTEEDGCESRKSIAETRPEEQRVSDSHSNAEV
GSLVSDACDDVLSQDLGSDSDNFSVEFEVESIDSDAYSDPEEASVSGEDEVYEVTIFEAE
EEDSFDDDTEITEADYWKCSKCEELNPPLPRNCNRCWTLRMDWFPDSDSNSAAPNLKPLP
PKPTPAPTEPDETEGLDVPDGKRARSPLPLLKDSQELMSVSGPDSQDSACSSQPSTSSSN
SNGVGSGSSSSAPLSQEVMAPDLERFNSLEAHLPASCLEPCVICQTRPKNGCIVHGRTGH
LMACYTCARKLKKRNKLCPVCRQPIQSVVLIYLS
NT seq 1365 nt   +upstreamnt  +downstreamnt
atggcagagaattgtgagagaatgtcagaatggcatagaagtagttcccaaataaatacc
ttggacaatgagaaacttgtacgacctaaagagaaactgcgtgtgttattgcagcaggca
ggtgcagacaaagacgttttcaccatgaaagaggtgatattctacnctggccagtacatc
atgaagaaacagctttatgacatgaagcagcaacacatagtgcactgtgctngagacccc
ctgggggctgtactgggagtggacagcttctctgtaaagaaccacggtgaggacacacac
tgcacggtgtggacatcttctccatcaaagagcccacgcactcacacaataacacacaca
gcttgggacggacaatcccatctgtcttcacggaacccaggagccagagtgaaccggata
gagggcctaagaggggacgtcgtcgacacagaggaggacgggtgtgagtccaggaagagc
atagctgagacgagaccggaggagcagcgagtttcagactcacacagtaacgctgaagta
ggttcattggtcagtgacgcgtgtgacgatgttctgagccaggatctgggctcagactct
gataacttcagcgtggagtttgaggtggagtccatcgactcggatgcctacagcgatccc
gaagaggcttcagtgtctggagaggacgaggtgtatgaagtcaccatcttcgaggcagag
gaggaggactcgttcgatgacgacactgaaatcacggaagcagactactggaagtgctca
aagtgtgaggagttgaaccctcccctcccccgaaactgcaaccgctgctggacgctaaga
atggactggtttcccgattctgacagcaactctgctgcccccaacctcaaacccttaccc
cccaagcctaccccagccccgacagagcctgacgagaccgaaggtctggatgttccagac
gggaagagagccaggtcgccccttcccctcctcaaagactcccaggaattgatgtccgtc
tctggccccgattcccaagactcggcctgctcctcccagccctccacctcttcttcgaac
tccaacggtgtgggctcaggctcgtcctctagcgcccccctcagtcaagaagtgatggca
ccagacttggagcgtttcaacagcctggaggctcacctccccgccagctgcctggagccc
tgcgtcatctgtcagaccaggcccaagaacggctgcattgtacacggacgcacagggcac
ctcatggcctgttacacctgcgccaggaaactgaagaagaggaacaagctgtgtcctgtc
tgcaggcagcctatccagtctgtcgtcttaatttatctcagctga

DBGET integrated database retrieval system