KEGG   Pseudomonas aeruginosa PAO1: PA1529
Entry
PA1529            CDS       T00035                                 

Gene name
lig
Definition
(RefSeq) NAD-dependent DNA ligase LigA
  KO
K01972  DNA ligase (NAD+) [EC:6.5.1.2]
Organism
pae  Pseudomonas aeruginosa PAO1
Pathway
pae03030  DNA replication
pae03410  Base excision repair
pae03420  Nucleotide excision repair
pae03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:pae00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    PA1529 (lig)
   03410 Base excision repair
    PA1529 (lig)
   03420 Nucleotide excision repair
    PA1529 (lig)
   03430 Mismatch repair
    PA1529 (lig)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:pae03032]
    PA1529 (lig)
   03400 DNA repair and recombination proteins [BR:pae03400]
    PA1529 (lig)
Enzymes [BR:pae01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.2  DNA ligase (NAD+)
     PA1529 (lig)
DNA replication proteins [BR:pae03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    Other elongation factors
     PA1529 (lig)
DNA repair and recombination proteins [BR:pae03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA ligase
     PA1529 (lig)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     PA1529 (lig)
   MMR (mismatch excision repair)
    DNA ligase
     PA1529 (lig)
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      PA1529 (lig)
SSDB
Motif
Pfam: DNA_ligase_aden DNA_ligase_OB HHH_2 DNA_ligase_ZBD BRCT HHH_5 PTCB-BRCT
Other DBs
NCBI-GeneID: 879269
NCBI-ProteinID: NP_250220
UniProt: Q9I3I4
LinkDB
Position
1666025..1668409
AA seq 794 aa
MTDTQAAAERIAQLRTELDTHNYRYYVLDEPSIPDAEYDRLFRELQALEAEYPQLLTPDS
PTQRVSGTPASAFGEVRHEIPMLSLGNAFEEQDLLDFDRRVREGLADLLPGGDLLGGGAE
VEYSCEPKLDGLAVSLLYERGQLVRGATRGDGSTGEDITSNVRTIRNVPLKLHGEGWPEI
LEVRGEVFMSKAGFEALNAKAVETGGKTFANPRNAAAGSLRQLDSKITASRPLEFCAYGF
GQVSGTLPDTQVGILEAFRGWGIPISRELRLVKGAQACRDYYDDIGRRRDALAYEIDGVV
FKVNRIAFQRELGFRAREPRWAIAHKFPAREELTELLGVEFQVGRTGAVTPVARLKPVQV
AGVTVSNATLHNMDEVARLGLRIGDTVVIRRAGDVIPQVMQVVLERRPADAQAIEVPEHC
PVCGSAVERTQLVKRSKGKESISEGAIYRCVGRLSCQAQLKQAIIHFVSRRAMDIDGLGD
KIVEQLVDRGLVASPADLYTLTYEQVFELEGFAELSTNNLLTAIADSRKPSLARFIFALG
IPDVGEETAKLLARSLGSLERIGKALPEVLTYLPDVGAEVAYEIHNFFADEHNRQVIAQL
RDAEHGVQLQEEGEVAAEFAACASLAGFIDKLNIPFIAATGAEKLASRFGSLDGIIRADW
LDLRQVERLPERAAKSLRDFFDEPANVQRALAIEAQLREFGMHWQSERKAVEGLPLAGQT
WVLTGTLEAMSRDVAKDKLEGLGAKVAGSVSAKTHCVVAGPGAGSKLAKANELGVKVLDE
DGLLKLFDEHGVAR
NT seq 2385 nt   +upstreamnt  +downstreamnt
atgaccgacacccaggctgccgccgaacgcatcgcgcaactgcgaaccgaactggacacc
cacaattaccgttactacgtgctcgacgaaccgagcattcccgacgccgaatacgatcgc
ctgttccgcgagttgcaggcgctggaggccgagtacccgcaactgctgacgcccgactcg
ccgacccagcgggtcagcggcacgccggcctcggcgttcggcgaagtgcgccatgagatc
cccatgctcagcctcggcaacgccttcgaggagcaggacctgctggacttcgaccgccgc
gtacgcgaaggactggccgacctgttgcctggcggcgacctgctcggcggtggcgcggag
gtcgagtacagttgcgagccgaagctggacggcctggccgtcagcctgctctacgaacgc
ggccaactggtgcgcggcgccacccgtggcgatggcagcaccggcgaggacatcaccagc
aacgtacgcaccattcgcaacgtaccgctgaagctgcacggcgaaggctggccggagatc
ctcgaagtgcgcggcgaggtgttcatgtccaaggccggtttcgaggcgctcaacgccaag
gccgtggaaaccggcggcaaaaccttcgccaacccgcgcaacgcggcggccggcagcctg
cgccagctggattcaaagatcaccgccagtcgcccgctggaattctgtgcctacggcttc
ggccaggtcagcgggacgctgccggacacccaggtgggcatcctcgaggcgttccgcggc
tggggtatccccatcagtcgcgagctgcgcctggtcaagggcgcccaggcctgccgcgac
tactacgacgacatcggtcgccgacgcgatgcgctggcctacgagatcgacggcgtggtg
ttcaaggtcaaccgcatcgccttccagcgcgaactgggcttccgcgcgcgcgagccgcgt
tgggcgatcgcccacaagttccccgcgcgcgaggagttgaccgagctgctgggtgtcgag
ttccaggtcggccgcaccggcgccgtgaccccggtggcacgcctcaagccggtgcaggtg
gccggcgtcacggtgtccaatgcgaccctgcacaacatggatgaagtcgcccgcctgggc
ctgcgcatcggtgatacggtggtgatccgccgtgctggcgatgtgattccgcaggtcatg
caggtggtgctcgagcgccgcccggcggatgcgcaggctatcgaggtgcccgagcattgc
ccggtctgcggctcggccgtggagcggacccagttggtcaagcgcagcaagggcaaggag
tcgatcagcgagggcgccatctatcgctgcgtcggccgcctctcctgtcaggcgcagttg
aagcaggcgatcatccatttcgtatcgcgccgggcaatggatatcgacggtcttggcgac
aagatcgtcgagcaactggtggatcgcgggctggtcgcctcgccggcggatctctatacc
ctgacctatgaacaggtgttcgagctggaagggttcgccgagctgtccaccaacaacctg
ctgacggctatcgccgatagccgcaagccttcgctggcgcgcttcatcttcgctctgggg
attcccgacgtcggcgaggaaaccgccaagctgctggcgcgttcgctgggttcgctcgag
cggatcggcaaggcgctcccggaagtgttgacctacctgccggacgtcggcgccgaggta
gcctacgagatccacaacttcttcgccgacgagcacaaccgccaggtgatcgcccagttg
cgcgatgccgaacatggcgtgcagttgcaggaagagggcgaggtcgccgcggagttcgcc
gcctgtgcctcgctggccggtttcatcgacaagctgaacattcccttcatcgccgccacc
ggcgcggaaaagctggctagccgcttcggttcgctcgacggcatcatccgtgccgactgg
ctcgatctgcgccaggtggagcgtctgcccgagcgagcggcgaaaagcctgcgcgatttc
ttcgacgagccggccaacgtgcagcgtgccctggccatcgaggcgcagttgcgtgagttc
ggcatgcattggcagagcgagcgcaaggcggtcgaaggcctgcctctggccgggcagacc
tgggtgctgaccggcaccctggaggcgatgagccgggacgtggccaaggacaagctggaa
gggctcggcgccaaggtggccggctcggtgtcggccaagacccactgcgtggtcgccggg
cccggcgccggctcgaagctggccaaggccaacgagctgggcgtgaaggtgctcgacgaa
gacggcctgctgaaactgttcgacgagcacggcgtcgcccgctga

DBGET integrated database retrieval system