KEGG   Planktothrix agardhii: NIES204_21080
Entry
NIES204_21080     CDS       T05658                                 

Gene name
tpi
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
pagh  Planktothrix agardhii
Pathway
pagh00010  Glycolysis / Gluconeogenesis
pagh00051  Fructose and mannose metabolism
pagh00562  Inositol phosphate metabolism
pagh00710  Carbon fixation in photosynthetic organisms
pagh01100  Metabolic pathways
pagh01110  Biosynthesis of secondary metabolites
pagh01120  Microbial metabolism in diverse environments
pagh01200  Carbon metabolism
pagh01230  Biosynthesis of amino acids
Module
pagh_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
pagh_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:pagh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NIES204_21080 (tpi)
   00051 Fructose and mannose metabolism
    NIES204_21080 (tpi)
   00562 Inositol phosphate metabolism
    NIES204_21080 (tpi)
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    NIES204_21080 (tpi)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pagh04147]
    NIES204_21080 (tpi)
Enzymes [BR:pagh01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     NIES204_21080 (tpi)
Exosome [BR:pagh04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   NIES204_21080 (tpi)
  Exosomal proteins of bladder cancer cells
   NIES204_21080 (tpi)
  Exosomal proteins of melanoma cells
   NIES204_21080 (tpi)
SSDB
Motif
Pfam: TIM
Other DBs
NCBI-ProteinID: BBD54812
UniProt: A0A2Z6CEX6
LinkDB
Position
2422069..2422761
AA seq 230 aa
MFKTQSEAQEFLQGFTNHLDDTPEDREVVLCVPFTTLGVMSKSLHGSRIFPGAQNIHWED
SGAYTGEISGPMLLEFGIRYVVVGHSERRQYFGETDETVNLRLRAAQRHGLTPILCVGET
KQQRDAGDTEGVIFSQLEKDLIGVDQNNLVIAYEPIWAIGTGDTCETTEANRVIGLIRSK
LVNSNVTIQYGGSVKPDNIDEIMAQPEIDGALVGGASLQPEGFARIVNYQ
NT seq 693 nt   +upstreamnt  +downstreamnt
atgtttaaaacccaatcggaagctcaagagtttctgcaagggtttactaatcatttagat
gatactccagaagacagggaagtggtgctgtgtgtaccctttaccacattgggtgtcatg
tcgaaaagtttacatgggagtcgaattttccccggtgctcaaaacatacattgggaagat
tctggagcctacacgggggaaatttctggcccgatgttactagaatttggtatccgttat
gttgttgtcggtcacagtgaacgacgtcaatattttggcgaaaccgatgaaactgtgaat
ttgcgacttagagcggctcaacgccatggtttaacccccattttatgtgtgggagaaacc
aaacaacaacgggatgctggagacaccgaaggggtgattttctctcagttggaaaaggat
ttaattggggttgatcaaaataatttagtcattgcttatgagccgatttgggcaatcgga
actggggatacttgtgaaaccactgaagcgaatcgggtaattggtttaattcgcagtaaa
ttagtcaattctaatgtcactattcaatatggtggctctgtcaaacctgataatattgat
gagattatggcacagccagaaattgatggggctttagttggaggcgctagtttacaacca
gaaggttttgcccgtattgttaattatcaataa

DBGET integrated database retrieval system