KEGG   Pteropus alecto (black flying fox): 102880085
Entry
102880085         CDS       T02993                                 

Gene name
CDKN1B
Definition
(RefSeq) cyclin-dependent kinase inhibitor 1B
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale01522  Endocrine resistance
pale04012  ErbB signaling pathway
pale04066  HIF-1 signaling pathway
pale04068  FoxO signaling pathway
pale04110  Cell cycle
pale04151  PI3K-Akt signaling pathway
pale04933  AGE-RAGE signaling pathway in diabetic complications
pale04934  Cushing syndrome
pale05162  Measles
pale05165  Human papillomavirus infection
pale05169  Epstein-Barr virus infection
pale05200  Pathways in cancer
pale05202  Transcriptional misregulation in cancer
pale05203  Viral carcinogenesis
pale05206  MicroRNAs in cancer
pale05215  Prostate cancer
pale05220  Chronic myeloid leukemia
pale05222  Small cell lung cancer
pale05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    102880085 (CDKN1B)
   04066 HIF-1 signaling pathway
    102880085 (CDKN1B)
   04068 FoxO signaling pathway
    102880085 (CDKN1B)
   04151 PI3K-Akt signaling pathway
    102880085 (CDKN1B)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102880085 (CDKN1B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102880085 (CDKN1B)
   05202 Transcriptional misregulation in cancer
    102880085 (CDKN1B)
   05206 MicroRNAs in cancer
    102880085 (CDKN1B)
   05203 Viral carcinogenesis
    102880085 (CDKN1B)
  09162 Cancer: specific types
   05226 Gastric cancer
    102880085 (CDKN1B)
   05220 Chronic myeloid leukemia
    102880085 (CDKN1B)
   05215 Prostate cancer
    102880085 (CDKN1B)
   05222 Small cell lung cancer
    102880085 (CDKN1B)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102880085 (CDKN1B)
   04934 Cushing syndrome
    102880085 (CDKN1B)
  09172 Infectious disease: viral
   05162 Measles
    102880085 (CDKN1B)
   05169 Epstein-Barr virus infection
    102880085 (CDKN1B)
   05165 Human papillomavirus infection
    102880085 (CDKN1B)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    102880085 (CDKN1B)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 102880085
NCBI-ProteinID: XP_006912692
UniProt: L5KK83
LinkDB
Position
Unknown
AA seq 198 aa
MSNVRVSNGSPSLERMDARQAEYPKPSACRNLFGPVNHEELTRDLEKHCRDMEEASQRKW
NFDFQNHKPLEGKYEWQEVEKSSLPEFYYRPPRPPKGACKVPAQESQDVSGNRQAVPLIG
SQANSEDTHLVDQKTDASDSQTGLAEPCTGIRKRPATDDASPQNKRANRTEENVSDASPN
AGSVEQTPKKPGLRRRQT
NT seq 597 nt   +upstreamnt  +downstreamnt
atgtcaaacgtgcgagtgtctaacgggagtccgagcttggagcggatggacgccagacag
gcggagtaccccaagccctccgcctgcagaaacctcttcggccccgtgaatcacgaagag
ttaacccgggacttggagaagcactgccgagacatggaagaggcaagccagcgcaagtgg
aattttgattttcagaatcacaagcccctggagggcaaatacgagtggcaggaggtggaa
aagagtagcttgcccgagttctactacagacccccgcggccacccaaaggcgcctgcaag
gtgcccgcgcaggagagccaggatgtcagcgggaaccgccaggcggtgcctttaattggg
tctcaggcaaactcagaggacacgcacttggtagaccaaaaaactgatgcatcggacagc
cagacgggcttagccgagccgtgcactgggataaggaagcgacctgcaacagacgatgcc
tctcctcaaaacaaaagagccaacagaacagaagaaaatgtgtcagatgcttccccaaac
gcaggttcggtggagcagacgcccaagaagccgggcctcagaagacgtcaaacgtaa

DBGET integrated database retrieval system