KEGG   Pteropus alecto (black flying fox): 102884281
Entry
102884281         CDS       T02993                                 

Gene name
MDM2
Definition
(RefSeq) E3 ubiquitin-protein ligase Mdm2
  KO
K06643  E3 ubiquitin-protein ligase Mdm2 [EC:2.3.2.27]
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale01522  Endocrine resistance
pale01524  Platinum drug resistance
pale04068  FoxO signaling pathway
pale04110  Cell cycle
pale04115  p53 signaling pathway
pale04120  Ubiquitin mediated proteolysis
pale04144  Endocytosis
pale04151  PI3K-Akt signaling pathway
pale04218  Cellular senescence
pale04625  C-type lectin receptor signaling pathway
pale04919  Thyroid hormone signaling pathway
pale05163  Human cytomegalovirus infection
pale05165  Human papillomavirus infection
pale05169  Epstein-Barr virus infection
pale05200  Pathways in cancer
pale05202  Transcriptional misregulation in cancer
pale05203  Viral carcinogenesis
pale05205  Proteoglycans in cancer
pale05206  MicroRNAs in cancer
pale05214  Glioma
pale05215  Prostate cancer
pale05218  Melanoma
pale05219  Bladder cancer
pale05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:pale00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    102884281 (MDM2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    102884281 (MDM2)
   04151 PI3K-Akt signaling pathway
    102884281 (MDM2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102884281 (MDM2)
  09143 Cell growth and death
   04110 Cell cycle
    102884281 (MDM2)
   04115 p53 signaling pathway
    102884281 (MDM2)
   04218 Cellular senescence
    102884281 (MDM2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    102884281 (MDM2)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    102884281 (MDM2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102884281 (MDM2)
   05202 Transcriptional misregulation in cancer
    102884281 (MDM2)
   05206 MicroRNAs in cancer
    102884281 (MDM2)
   05205 Proteoglycans in cancer
    102884281 (MDM2)
   05203 Viral carcinogenesis
    102884281 (MDM2)
  09162 Cancer: specific types
   05214 Glioma
    102884281 (MDM2)
   05220 Chronic myeloid leukemia
    102884281 (MDM2)
   05218 Melanoma
    102884281 (MDM2)
   05219 Bladder cancer
    102884281 (MDM2)
   05215 Prostate cancer
    102884281 (MDM2)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    102884281 (MDM2)
   05169 Epstein-Barr virus infection
    102884281 (MDM2)
   05165 Human papillomavirus infection
    102884281 (MDM2)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    102884281 (MDM2)
   01522 Endocrine resistance
    102884281 (MDM2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pale04131]
    102884281 (MDM2)
   04121 Ubiquitin system [BR:pale04121]
    102884281 (MDM2)
Enzymes [BR:pale01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     102884281 (MDM2)
Membrane trafficking [BR:pale04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    102884281 (MDM2)
Ubiquitin system [BR:pale04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   MDM2/MDM4 proteins
    102884281 (MDM2)
SSDB
Motif
Pfam: zf-C3HC4_3 SWIB zf-RanBP zf-RING_2 DUF1229 zf-FPG_IleRS
Other DBs
NCBI-GeneID: 102884281
NCBI-ProteinID: XP_006923785
LinkDB
Position
Unknown
AA seq 492 aa
MCNTSMSVSTDGAVSTSQIPASEQETLVRPKPLLLKLLKSVGAQKDTYTMKEVIFYLGQY
IMNKRLYDEKQQHIVYCSNDLLGDLFGVPSFSVKEHRKIYTMIYRNLVVVNQQEPSDSGI
PVSENRCHLESGSDEKDPVQELQEEKPSSSDLVSRPSASSRRRTISETEDNSDELPGERQ
RKRHKSDSISFSFDESLALCVIREIRCERNSSSESTGTSSNPDLDAGVSEHSGDWLDQDS
VSDRFSVEFEVESFNSEDYNLSEEGQELSDEDDEVYQVTVYQAGESDTDSFEDDPEISLA
DYWKCTSCSEMNPPLPPHCNRCWALRENWLPEDKRKEKGKMDEKTELENSVQVEEGFDVP
DCKKNPTVYDSRESCIEENDEKITQASQSQESEDYSQPSTSSSIIYSSQEDVKELEKEET
QDKEESVESSFPLNAIEPCVICQGRPKNGCIVHGKTGHLMACFTCAKKLKKRNKPCPVCR
QPIQMIVLTYFS
NT seq 1479 nt   +upstreamnt  +downstreamnt
atgtgcaataccagcatgtctgtgtctactgatggtgctgtaagcacctcacagattcca
gcttcagagcaagagaccctggttagaccaaagccattacttttgaagttgttgaaatct
gttggtgcacaaaaagacacttacactatgaaagaggttatattttatcttggccagtat
attatgaacaaacgattatatgatgagaagcaacagcatattgtatattgttcaaatgat
cttctaggggatttgtttggagtgccaagcttctctgtgaaagaacacaggaaaatatat
acaatgatctacagaaacttggtagtagtcaatcagcaggaaccatcagattcaggcata
cctgtgagtgaaaacaggtgtcatcttgaaagtgggagtgatgaaaaggaccctgtgcaa
gagctacaagaagaaaaaccttcatcttcagatttggtttctagaccatctgcctcatct
agaaggagaacgattagtgagacagaagacaattcagatgaattacctggtgaacgacaa
agaaagcgccacaaatctgatagtatttccttttcctttgatgaaagccttgctctgtgt
gtaataagggagatacgttgtgaaagaaacagtagcagtgaatcaacagggacttcatca
aatccggatctcgatgctggtgtcagtgaacattcaggtgattggttggatcaggattca
gtttcagatcgattcagtgtagaatttgaagttgagtctttcaattcggaagattataac
cttagtgaagaaggacaagaactctcagatgaagatgatgaggtatatcaagttaccgtg
tatcaggcaggggaaagtgatacggattcatttgaagacgaccctgaaatctccttagct
gactattggaagtgtacttcatgcagtgaaatgaatcctccccttccaccacattgcaac
agatgctgggcccttcgtgagaattggcttcctgaagacaaaaggaaagaaaaagggaaa
atggatgagaaaactgaacttgaaaactcagtacaagtagaagagggctttgatgtccct
gattgtaaaaaaaatcctacagtgtatgattcccgagaatcatgtattgaggaaaatgat
gaaaagatcacacaagcctcccaatcccaagaaagtgaagactattctcagccatcaact
tctagtagcatcatttatagcagccaagaagatgtcaaagagttagagaaagaagaaaca
caagacaaagaagaaagtgtggagtctagttttccacttaatgccatcgaaccttgtgtg
atttgccaaggtcgacctaaaaatggttgcatcgtccatggcaaaacaggacatcttatg
gcatgttttacatgtgcaaagaagctaaagaaaaggaacaagccctgcccagtatgtaga
caaccaattcaaatgatcgtgttaacttatttctcctag

DBGET integrated database retrieval system