KEGG   Parvularcula bermudensis: PB2503_08724Help
Entry
PB2503_08724      CDS       T01298                                 

Definition
(GenBank) pyrroline-5-carboxylate reductase
  KO
K00286  pyrroline-5-carboxylate reductase [EC:1.5.1.2]
Organism
pbr  Parvularcula bermudensis
Pathway
pbr00330  Arginine and proline metabolism
pbr01100  Metabolic pathways
pbr01110  Biosynthesis of secondary metabolites
pbr01130  Biosynthesis of antibiotics
pbr01230  Biosynthesis of amino acids
Module
pbr_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:pbr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    PB2503_08724
Enzymes [BR:pbr01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.2  pyrroline-5-carboxylate reductase
     PB2503_08724
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: P5CR_dimer F420_oxidored
Motif
Other DBs
NCBI-ProteinID: ADM09800
UniProt: E0TC07
LinkDB All DBs
Position
1740730..1741551
Genome map
AA seq 273 aa AA seqDB search
MTNKLSLLLVGAGNMGGALFTSWVEKGVLDPARSAISDPNPSDAVIALAEKAGIAINPED
DQPYEVCVLGIKPQLFGAVLPDLQFGGMNDALFISMAAGTSLGEIGKLLKGQAPNARLVR
TMPNLPAAIGEGMSLLCAGEGVTDKDKAAATALMEAAGQVVWTKTEDDVDRLTGVSGSGP
GFVLYVVEAFEAAAKAQGASDSDARLLAEQTIIGTALHLSRDGRTAAELRKAVTSPGGTT
EAGLNVLMADERLHRLIAEAVEAAYDRAQELSS
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgaccaataaactctctctcctgctcgtcggcgccggtaatatgggcggcgctcttttc
acttcttgggtcgagaaaggcgtccttgacccggcacggtcggcgatctccgaccccaat
ccgtccgatgccgtcattgcccttgccgaaaaagcgggcatcgccatcaatcccgaagac
gatcaaccctatgaggtgtgtgtgctcgggataaaaccgcagctctttggcgccgtcctg
cccgatctgcagtttggcggcatgaatgacgccctctttatttccatggcggctgggacg
agccttggggaaatcggcaagctccttaaggggcaggcgcccaatgcccgtcttgtgcgg
acgatgcccaatctgcccgccgccatcggcgaaggcatgtcgctgctttgcgcgggcgag
ggcgtaactgacaaggacaaggccgccgcgaccgccctcatggaggccgctgggcaggtc
gtttggaccaagacagaagacgatgtcgaccggttgaccggtgtgtcgggcagtgggccg
ggctttgtgctctatgtggtcgaagccttcgaggcggcggccaaagcgcaaggggcgagc
gacagcgatgcgcgcttactggccgaacagacgatcattggtaccgcgctccatctctcg
cgggatggtcggaccgctgctgaattgcgcaaggcggtgacctctcccggcggcacgacg
gaagcgggcctcaatgtgttgatggcggatgaacgccttcaccgtctgatcgccgaggcc
gtagaggcggcctatgaccgagctcaagaattgtcgagctga

DBGET integrated database retrieval system