KEGG   Physeter catodon (sperm whale): 102975643
Entry
102975643         CDS       T06011                                 

Gene name
TGFB1
Definition
(RefSeq) transforming growth factor beta-1 proprotein isoform X1
  KO
K13375  transforming growth factor beta-1
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad04010  MAPK signaling pathway
pcad04060  Cytokine-cytokine receptor interaction
pcad04068  FoxO signaling pathway
pcad04110  Cell cycle
pcad04218  Cellular senescence
pcad04350  TGF-beta signaling pathway
pcad04380  Osteoclast differentiation
pcad04390  Hippo signaling pathway
pcad04659  Th17 cell differentiation
pcad04672  Intestinal immune network for IgA production
pcad04926  Relaxin signaling pathway
pcad04932  Non-alcoholic fatty liver disease
pcad04933  AGE-RAGE signaling pathway in diabetic complications
pcad05140  Leishmaniasis
pcad05142  Chagas disease
pcad05144  Malaria
pcad05145  Toxoplasmosis
pcad05146  Amoebiasis
pcad05152  Tuberculosis
pcad05161  Hepatitis B
pcad05166  Human T-cell leukemia virus 1 infection
pcad05200  Pathways in cancer
pcad05205  Proteoglycans in cancer
pcad05210  Colorectal cancer
pcad05211  Renal cell carcinoma
pcad05212  Pancreatic cancer
pcad05220  Chronic myeloid leukemia
pcad05225  Hepatocellular carcinoma
pcad05226  Gastric cancer
pcad05321  Inflammatory bowel disease
pcad05323  Rheumatoid arthritis
pcad05410  Hypertrophic cardiomyopathy
pcad05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102975643 (TGFB1)
   04350 TGF-beta signaling pathway
    102975643 (TGFB1)
   04390 Hippo signaling pathway
    102975643 (TGFB1)
   04068 FoxO signaling pathway
    102975643 (TGFB1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102975643 (TGFB1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102975643 (TGFB1)
   04218 Cellular senescence
    102975643 (TGFB1)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    102975643 (TGFB1)
   04672 Intestinal immune network for IgA production
    102975643 (TGFB1)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    102975643 (TGFB1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102975643 (TGFB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102975643 (TGFB1)
   05205 Proteoglycans in cancer
    102975643 (TGFB1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102975643 (TGFB1)
   05212 Pancreatic cancer
    102975643 (TGFB1)
   05225 Hepatocellular carcinoma
    102975643 (TGFB1)
   05226 Gastric cancer
    102975643 (TGFB1)
   05220 Chronic myeloid leukemia
    102975643 (TGFB1)
   05211 Renal cell carcinoma
    102975643 (TGFB1)
  09163 Immune disease
   05323 Rheumatoid arthritis
    102975643 (TGFB1)
   05321 Inflammatory bowel disease
    102975643 (TGFB1)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    102975643 (TGFB1)
   05414 Dilated cardiomyopathy
    102975643 (TGFB1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    102975643 (TGFB1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102975643 (TGFB1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    102975643 (TGFB1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102975643 (TGFB1)
   05161 Hepatitis B
    102975643 (TGFB1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102975643 (TGFB1)
   05144 Malaria
    102975643 (TGFB1)
   05145 Toxoplasmosis
    102975643 (TGFB1)
   05140 Leishmaniasis
    102975643 (TGFB1)
   05142 Chagas disease
    102975643 (TGFB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:pcad03110]
    102975643 (TGFB1)
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pcad04052]
    102975643 (TGFB1)
   00536 Glycosaminoglycan binding proteins [BR:pcad00536]
    102975643 (TGFB1)
Chaperones and folding catalysts [BR:pcad03110]
 Intramolecular chaperones
  Others
   102975643 (TGFB1)
Cytokines and growth factors [BR:pcad04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   102975643 (TGFB1)
Glycosaminoglycan binding proteins [BR:pcad00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   102975643 (TGFB1)
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta
Other DBs
NCBI-GeneID: 102975643
NCBI-ProteinID: XP_023988444
UniProt: A0A2Y9TIY3
LinkDB
Position
Unknown
AA seq 391 aa
MPPSGLRLLPLLLPLLWLLVLPPGRPAAGLSTCKTIDMELVKRKRIEAIRGQILSKLRLA
SPPSQGEVPPGPLPEAVLALYNSTRDRVAGESAEPEPEPEADYYAKEVTRVLMVENSNEI
YGKIKRSPHSMYMLFNTSELREAVPEPVLLSRAELRLLRLKLKVEQHVELYQKYSNDSWR
YLSNRLLAPSDSPEWLSFDVTGVVRQWLTHGEEIEGFRLSAHCSCDSKDNTLQVDINAGF
SSGRRGDLATIHGMNRPFLLLMATPLERAQHLHSPRHRRALDTNYCFSSTEKNCCVRQLY
IDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQ
ALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
NT seq 1176 nt   +upstreamnt  +downstreamnt
atgccgccctcggggctgcggctgctgccgctgctgctgccgctgctgtggctactagtg
ctgccgcctggccggccggccgccggactgtccacctgcaagaccatcgacatggagctg
gtgaagcgaaagcgcatcgaggccatccgaggccagattctgtccaagcttcggctcgcc
agccccccgagccagggggaggtgccgcccggtccgctgcccgaggccgtactggcgctt
tacaacagtacccgtgaccgggtggccggggaaagtgccgaacctgagcctgagccagag
gcggactactacgccaaggaggtcacccgcgtgctcatggtggaaaacagcaacgaaatc
tatgggaagatcaagcgtagcccacacagcatgtatatgctcttcaacacgtccgagctc
cgggaagcggtgcccgaacctgtgttgctctctcgggcagagctgcgcctgctgaggctc
aagttaaaagtggagcagcacgtggagctgtaccagaaatacagcaatgattcctggcgc
tacctcagcaaccggctgctggcccccagcgactcaccagagtggctgtcctttgatgtc
actggagttgtgcggcagtggctgacccacggagaggaaatagagggctttcgcctcagt
gcccactgttcctgtgacagcaaagataacacactccaagtggacattaacgcagggttc
agttccggccgccggggtgacctcgccaccattcatggcatgaaccggcccttcctgctc
ctcatggccaccccgctggagagggcccagcacctgcacagcccccggcaccgccgagcc
ctggacaccaactactgcttcagctccacggaaaagaactgctgcgttcggcagctctac
attgacttccgcaaggacctgggctggaagtggattcacgaacccaagggctaccacgcc
aatttctgcctggggccctgcccctacatctggagcctggacacgcagtacagcaaggtc
ctggccctgtacaaccagcacaacccgggcgcgtcggcggcgccgtgctgcgtgccgcag
gcgctggagccgctgcccatcgtgtactacgtgggccgcaagcccaaggtggagcagctg
tccaacatgatcgtgcgctcctgcaagtgcagctga

KEGG   Physeter catodon (sperm whale): 102977345
Entry
102977345         CDS       T06011                                 

Gene name
TGFB3
Definition
(RefSeq) transforming growth factor beta-3 proprotein
  KO
K13377  transforming growth factor beta-3
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad04010  MAPK signaling pathway
pcad04060  Cytokine-cytokine receptor interaction
pcad04068  FoxO signaling pathway
pcad04110  Cell cycle
pcad04218  Cellular senescence
pcad04350  TGF-beta signaling pathway
pcad04390  Hippo signaling pathway
pcad04933  AGE-RAGE signaling pathway in diabetic complications
pcad05140  Leishmaniasis
pcad05142  Chagas disease
pcad05144  Malaria
pcad05145  Toxoplasmosis
pcad05146  Amoebiasis
pcad05152  Tuberculosis
pcad05161  Hepatitis B
pcad05166  Human T-cell leukemia virus 1 infection
pcad05200  Pathways in cancer
pcad05210  Colorectal cancer
pcad05211  Renal cell carcinoma
pcad05212  Pancreatic cancer
pcad05220  Chronic myeloid leukemia
pcad05225  Hepatocellular carcinoma
pcad05226  Gastric cancer
pcad05321  Inflammatory bowel disease
pcad05323  Rheumatoid arthritis
pcad05410  Hypertrophic cardiomyopathy
pcad05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102977345 (TGFB3)
   04350 TGF-beta signaling pathway
    102977345 (TGFB3)
   04390 Hippo signaling pathway
    102977345 (TGFB3)
   04068 FoxO signaling pathway
    102977345 (TGFB3)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102977345 (TGFB3)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102977345 (TGFB3)
   04218 Cellular senescence
    102977345 (TGFB3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102977345 (TGFB3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102977345 (TGFB3)
   05212 Pancreatic cancer
    102977345 (TGFB3)
   05225 Hepatocellular carcinoma
    102977345 (TGFB3)
   05226 Gastric cancer
    102977345 (TGFB3)
   05220 Chronic myeloid leukemia
    102977345 (TGFB3)
   05211 Renal cell carcinoma
    102977345 (TGFB3)
  09163 Immune disease
   05323 Rheumatoid arthritis
    102977345 (TGFB3)
   05321 Inflammatory bowel disease
    102977345 (TGFB3)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    102977345 (TGFB3)
   05414 Dilated cardiomyopathy
    102977345 (TGFB3)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102977345 (TGFB3)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    102977345 (TGFB3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102977345 (TGFB3)
   05161 Hepatitis B
    102977345 (TGFB3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102977345 (TGFB3)
   05144 Malaria
    102977345 (TGFB3)
   05145 Toxoplasmosis
    102977345 (TGFB3)
   05140 Leishmaniasis
    102977345 (TGFB3)
   05142 Chagas disease
    102977345 (TGFB3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pcad04052]
    102977345 (TGFB3)
Cytokines and growth factors [BR:pcad04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   102977345 (TGFB3)
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta
Other DBs
NCBI-GeneID: 102977345
NCBI-ProteinID: XP_007129241
UniProt: A0A2Y9FTE4
LinkDB
Position
Unknown
AA seq 456 aa
MHLLAKPQSSGSREAAWFSSLLLHVCWGLLLTRPRSPRASLPCSRMKMHLQRALVVLALL
NFATVSLSMSTCTTLDFDHIKRKRVEAIRGQILSKLRLTSPPDPSVLANIPTQVLDLYNS
TRELLEEVHGERGDDCTQENTESEYYAKEIYKFDMIQGLEEHNDLAVCPKGITSKIFRFN
VSSVEKNETNLFRAEFRVLRMPNPSSKRSEQRIELFQILQPDEHIAKQRYLDGKNLPTRG
TAEWLSFDVTDTVREWLLRRESNLGLEISIHCPCHTFQPNGDILENIQEVMEIKFKGVDS
EDDPGRGDLGRLKKKKEHSPHLILMMIPPDRLDNPGQGGQRKKRALDTNYCFRNLEENCC
VRPLYIDFRQDLGWKWVHEPKGYYANFCSGPCPYLRSADTTHSSVLGLYNTLNPEASASP
CCVPQDLEPLTILYYVGRTAKVEQLSNMVVKSCKCS
NT seq 1371 nt   +upstreamnt  +downstreamnt
atgcaccttcttgccaagcctcagtcttcgggatctagggaggccgcctggttttcctcc
ctccttctgcacgtctgctggggtctcctcctcaccaggcctcgcagcccccgggcctct
ctcccctgctcacgcatgaagatgcacttgcaaagggctctggtggtcctggccctgctg
aactttgccacggtcagtctctccatgtccacttgcaccaccttggacttcgaccacatc
aagaggaagcgggtggaagccattaggggacagatcttgagcaaactcaggctcaccagt
ccccccgatccatcggtgttggccaacatccccacccaggtcctggacctttacaacagc
acccgagagctgctggaagaggtgcacggggagaggggagacgactgcactcaggaaaac
accgagtcggagtactatgccaaagaaatctataaattcgacatgatccaggggctggag
gagcacaacgacctggccgtctgtcccaaaggaatcacctccaagattttccgcttcaac
gtgtcctcagtggagaaaaatgaaaccaacctgttccgggcggaattccgggtcttgcgg
atgcccaaccccagctccaagcgcagcgagcagaggattgaactcttccagatcctccag
ccggatgagcacatagccaagcagcgctatcttgatggcaagaatctgcccacacggggc
actgctgagtggctgtctttcgacgtcacagacaccgtgcgtgaatggctcttacgaaga
gaatccaacttaggtctggaaatcagcattcattgtccatgtcacacctttcagcccaat
ggggatatcctggaaaacattcaagaggtgatggaaatcaaattcaaaggtgtggacagt
gaggatgatccaggcagaggagatctggggcgactaaagaagaaaaaggaacacagccct
catttaatcctcatgatgattcccccagaccggctggacaacccgggccagggaggtcag
aggaagaagcgggccctggacaccaattactgcttccgcaatctggaggagaactgctgt
gtgcgcccgctctacattgacttccgacaggatctgggctggaaatgggtccatgaacct
aagggctactacgccaacttctgctcgggcccgtgcccgtacctccgcagcgcagacact
acccacagctcagtgctgggactgtacaacaccctgaaccctgaagcctcggcctcccct
tgctgcgtaccccaggacttggagcccctgaccatcctgtactatgtcgggaggaccgcc
aaggtggagcagctctctaacatggtggtgaagtcctgcaagtgcagctga

KEGG   Physeter catodon (sperm whale): 102993033
Entry
102993033         CDS       T06011                                 

Gene name
TGFB2
Definition
(RefSeq) transforming growth factor beta-2 proprotein isoform X1
  KO
K13376  transforming growth factor beta-2
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad04010  MAPK signaling pathway
pcad04060  Cytokine-cytokine receptor interaction
pcad04068  FoxO signaling pathway
pcad04110  Cell cycle
pcad04218  Cellular senescence
pcad04350  TGF-beta signaling pathway
pcad04380  Osteoclast differentiation
pcad04390  Hippo signaling pathway
pcad04933  AGE-RAGE signaling pathway in diabetic complications
pcad05140  Leishmaniasis
pcad05142  Chagas disease
pcad05144  Malaria
pcad05145  Toxoplasmosis
pcad05146  Amoebiasis
pcad05152  Tuberculosis
pcad05161  Hepatitis B
pcad05166  Human T-cell leukemia virus 1 infection
pcad05200  Pathways in cancer
pcad05205  Proteoglycans in cancer
pcad05206  MicroRNAs in cancer
pcad05210  Colorectal cancer
pcad05211  Renal cell carcinoma
pcad05212  Pancreatic cancer
pcad05220  Chronic myeloid leukemia
pcad05225  Hepatocellular carcinoma
pcad05226  Gastric cancer
pcad05321  Inflammatory bowel disease
pcad05323  Rheumatoid arthritis
pcad05410  Hypertrophic cardiomyopathy
pcad05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102993033 (TGFB2)
   04350 TGF-beta signaling pathway
    102993033 (TGFB2)
   04390 Hippo signaling pathway
    102993033 (TGFB2)
   04068 FoxO signaling pathway
    102993033 (TGFB2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102993033 (TGFB2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102993033 (TGFB2)
   04218 Cellular senescence
    102993033 (TGFB2)
 09150 Organismal Systems
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102993033 (TGFB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102993033 (TGFB2)
   05206 MicroRNAs in cancer
    102993033 (TGFB2)
   05205 Proteoglycans in cancer
    102993033 (TGFB2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102993033 (TGFB2)
   05212 Pancreatic cancer
    102993033 (TGFB2)
   05225 Hepatocellular carcinoma
    102993033 (TGFB2)
   05226 Gastric cancer
    102993033 (TGFB2)
   05220 Chronic myeloid leukemia
    102993033 (TGFB2)
   05211 Renal cell carcinoma
    102993033 (TGFB2)
  09163 Immune disease
   05323 Rheumatoid arthritis
    102993033 (TGFB2)
   05321 Inflammatory bowel disease
    102993033 (TGFB2)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    102993033 (TGFB2)
   05414 Dilated cardiomyopathy
    102993033 (TGFB2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102993033 (TGFB2)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    102993033 (TGFB2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102993033 (TGFB2)
   05161 Hepatitis B
    102993033 (TGFB2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102993033 (TGFB2)
   05144 Malaria
    102993033 (TGFB2)
   05145 Toxoplasmosis
    102993033 (TGFB2)
   05140 Leishmaniasis
    102993033 (TGFB2)
   05142 Chagas disease
    102993033 (TGFB2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pcad04052]
    102993033 (TGFB2)
   00536 Glycosaminoglycan binding proteins [BR:pcad00536]
    102993033 (TGFB2)
Cytokines and growth factors [BR:pcad04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   102993033 (TGFB2)
Glycosaminoglycan binding proteins [BR:pcad00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   102993033 (TGFB2)
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta SPEG_u2
Other DBs
NCBI-GeneID: 102993033
NCBI-ProteinID: XP_007126194
UniProt: A0A2Y9FNU6
LinkDB
Position
4
AA seq 442 aa
MHYCVLSAFLLLHLVTVALSLSTCSTLDMDQFMRKRIQAIRGQILSKLKLTSPPEDYPEP
EEVPPEVISIYNSTRDLLQEKASRRAAACERERSDEEYYAKEVYKIDMPPFFPSETVCPV
VTTPSGSVGSLCSRQPQVLCGYLDAIPPTFYRPYFRIVRFDVSAMEKNASNLVKAEFRVF
RLQNPKARVPEQRIELYQILKSKDLTSPTQRYIDSKVVKTRAEGEWLSFDVTDAVHEWLH
HKDRNLGFKISLHCPCCTFVPSNNYIIPNKSEELEARFAGIDGTSTYTSGDQKTIKSTRK
KNSGKTPHLLLMLLPSYRLESQQSNRRKKRALDAAYCFRNVQDNCCLRPLYIDFKRDLGW
KWIHEPKGYNANFCAGACPYLWSSDTQHSRVLSLYNTINPEASASPCCVSQDLEPLTILY
YIGKTPKIEQLSNMIVKSCKCS
NT seq 1329 nt   +upstreamnt  +downstreamnt
atgcactactgtgtgctgagcgcttttctgctcctgcatctggtcacggtcgcgctcagc
ctgtctacctgcagcacgctcgacatggaccagttcatgcgcaagaggatccaggcgatc
cgcggacagatcctgagcaagctgaaactcaccagccccccagaagactaccccgaaccc
gaggaggtccccccggaggtgatttccatctacaacagcacaagggacttgctccaggag
aaggcgagccggagggcggccgcctgcgagcgcgagcggagcgacgaggagtactacgcc
aaggaggtttacaaaatagacatgccgcccttcttcccctcggaaactgtctgcccagtt
gttacaacaccctctggctcagtgggcagcttgtgctccagacagccccaggtgctctgt
gggtaccttgatgccatcccgcccactttctacagaccctacttcagaattgtccgattt
gacgtctccgccatggagaagaatgcttccaatttggtgaaggccgagttcagagtcttt
cgtttacagaacccgaaagccagagtgcctgaacaacggatcgaactgtatcagattctc
aaatccaaagatttaacatcgccaacccagcgctacatcgacagcaaagtcgtgaaaacc
agagcagagggcgaatggctctccttcgatgtcactgatgctgttcacgaatggctccac
cataaagacaggaatctgggatttaaaataagtttacactgtccctgctgcacctttgta
ccatcgaataattacatcatccccaacaaaagtgaagaactagaagcgcgatttgcaggt
attgatggcacctccacatataccagtggtgatcagaaaacaataaagtccactaggaaa
aaaaacagtgggaagaccccacatctcctgctaatgttgttaccctcctacagacttgag
tcacaacagtccaaccggcggaagaagcgtgctttggatgcagcctattgctttagaaat
gtgcaggataattgttgcctacgcccactttacattgatttcaagagggatcttgggtgg
aaatggatacatgagcctaaagggtacaatgccaacttctgtgctggagcgtgcccatat
ctgtggagctcagacactcagcacagtagggttctcagcttatataataccataaatcca
gaagcatctgcttccccttgctgcgtgtcccaggatttagaacctctcaccattctctac
tacatcggcaaaacacccaagattgaacagctttctaatatgatcgtaaagtcttgcaaa
tgcagctaa

DBGET integrated database retrieval system