KEGG   Physeter catodon (sperm whale): 102976084
Entry
102976084         CDS       T06011                                 

Gene name
HMOX1
Definition
(RefSeq) heme oxygenase 1
  KO
K00510  heme oxygenase 1 [EC:1.14.14.18]
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad00860  Porphyrin and chlorophyll metabolism
pcad01100  Metabolic pathways
pcad04066  HIF-1 signaling pathway
pcad04216  Ferroptosis
pcad04978  Mineral absorption
pcad05200  Pathways in cancer
pcad05206  MicroRNAs in cancer
pcad05225  Hepatocellular carcinoma
pcad05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    102976084 (HMOX1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    102976084 (HMOX1)
 09140 Cellular Processes
  09143 Cell growth and death
   04216 Ferroptosis
    102976084 (HMOX1)
 09150 Organismal Systems
  09154 Digestive system
   04978 Mineral absorption
    102976084 (HMOX1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102976084 (HMOX1)
   05206 MicroRNAs in cancer
    102976084 (HMOX1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    102976084 (HMOX1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102976084 (HMOX1)
Enzymes [BR:pcad01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.18  heme oxygenase (biliverdin-producing)
     102976084 (HMOX1)
SSDB
Motif
Pfam: Heme_oxygenase
Other DBs
NCBI-GeneID: 102976084
NCBI-ProteinID: XP_007101964
UniProt: A0A2Y9EI00
LinkDB
Position
6
AA seq 288 aa
MERPQPDSMPQDLSEALKEATKEVHILAENAEFMKNFQKGEVTREGFKLIMASLYHIYVA
LEEEIEHNKENPVFAPLYFPEELHRRGALEQDMAFWYGSRWQEAIPYTQATRRYVQRLQE
VGRAEPELLVAHTYTRYLGDLSGGQVLKKIAQKALDLPSSGEGLAFFTFPNIASATKFKQ
LYRSRMNTLEMTPEVKKRVLDEAKTAFLLNIKLFEELQGLLTQDAKDQSPSRAPDLRRRA
GSRAQDSAPTDASRGKPQLSILSQVPLMRWVLTFSFLVATVAVGLYTM
NT seq 867 nt   +upstreamnt  +downstreamnt
atggagcgcccgcagcccgacagcatgccccaggatttgtcagaggccctgaaggaggcc
accaaggaggtgcacatcctggcagagaatgccgagttcatgaagaactttcagaagggc
gaggtgacccgagaaggctttaagctgataatggcatctctgtaccacatctatgtggcc
ctggaggaggagatcgaacacaacaaggagaatccggtctttgctcccctctacttcccg
gaagagctgcaccgaaggggggccctcgagcaggacatggccttctggtacgggtcccgc
tggcaggaggccatcccctacacgcaggccaccaggcgttacgtgcagcgactccaagag
gtggggcgtgccgagcccgagctgctggtggcccacacctacacccgctacctgggtgac
ctgtctgggggccaggtcctcaagaagattgctcagaaggccctggacctgcccagctcc
ggagagggcctggccttcttcacttttcccaacatcgccagtgccaccaagttcaagcag
ctgtaccgctcccgtatgaacactctggagatgacccccgaggtcaagaagagggtcctc
gatgaggccaagactgccttcctgctcaacatcaagctgtttgaggagttgcaggggctg
ctgactcaggacgccaaggaccagagcccctcgcgggcaccagaccttcgcaggcgggct
ggcagcagggcgcaagactctgctcccacagacgcgtccagggggaagccccagctcagc
atcctctcccaggtgccgctcatgcgatgggtgctcacgttcagctttctggtggcaacg
gtcgccgtggggctttacaccatgtga

DBGET integrated database retrieval system