KEGG   Physeter catodon (sperm whale): 102979937
Entry
102979937         CDS       T06011                                 

Gene name
STK4
Definition
(RefSeq) serine/threonine-protein kinase 4
  KO
K04411  serine/threonine kinase 4
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad04010  MAPK signaling pathway
pcad04014  Ras signaling pathway
pcad04068  FoxO signaling pathway
pcad05200  Pathways in cancer
pcad05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102979937 (STK4)
   04014 Ras signaling pathway
    102979937 (STK4)
   04068 FoxO signaling pathway
    102979937 (STK4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102979937 (STK4)
  09162 Cancer: specific types
   05223 Non-small cell lung cancer
    102979937 (STK4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pcad01001]
    102979937 (STK4)
Protein kinases [BR:pcad01001]
 Serine/threonine kinases: STE group
  STE20 family
   102979937 (STK4)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Mst1_SARAH Pkinase_fungal Abi_2 DUF4611
Other DBs
NCBI-GeneID: 102979937
NCBI-ProteinID: XP_028354228
UniProt: A0A455C2S8
LinkDB
Position
14
AA seq 471 aa
MQDDDISFNHHNCLVVVLLSFYRSYGSVYKAIHKETGQIVAIKQVPVESDLQEIIKEISI
MQQCDSPHVVKYYGSYFKNTDLWIVMEYCGAGSVSDIIRLRNKTLTEDEIATILQSTLKG
LEYLHFMRKIHRDIKAGNILLNTEGHAKLADFGVAGQLTDTMAKRNTVIGTPFWMAPEVI
QEIGYNCVADIWSLGITAIEMAEGKPPYADIHPMRAIFMIPTNPPPTFRKPELWSDSFMD
FVKQCLIKSPEQRATATQLLQHPFVKSAKGVSILRDLINEAMDVKLKRQEAQQREVDQDD
EENSEEDEMDSGTMVRAAGDEMGTVRVASTMSDGANTMIEHDDTLPSQLGTMVINSEEEE
EEGTMKRRDETMQPARPSFLEYFEQKEKENQINSFGKSVPGPLKNSSDWKVPQDGDYEFL
KSWTVEDLQKRLLALDPMMEQEIEEIRQKYQSKRQPILDAIEAKKRRQQNF
NT seq 1416 nt   +upstreamnt  +downstreamnt
atgcaagatgatgatatctcatttaaccatcacaattgtcttgtagtagtattgttgtcg
ttttacaggtcctatggcagcgtgtacaaagctattcataaagagacaggtcagattgtt
gctattaagcaagttcctgtggagtcagacctgcaggagataatcaaagaaatctctata
atgcagcaatgtgacagccctcacgtagtcaaatattatggcagttattttaagaacaca
gacttgtggattgtgatggagtactgtggggctggttctgtgtctgatatcattcgatta
cgaaataaaacgttaacagaagatgaaatagctacaatattacagtcaacacttaaggga
ctggaataccttcattttatgagaaaaatacaccgagatatcaaggcaggaaatattttg
ctaaatacagaaggtcatgccaaacttgcagattttggggtagcaggtcaacttacagat
accatggccaagcgaaatacagtgataggaacaccattttggatggctccagaagtgatt
caggaaattgggtacaactgtgtggcagacatctggtcgttgggaataacagccatagaa
atggctgaaggaaagcccccatatgccgatatccatccaatgagggcaatcttcatgatt
cctaccaacccacctcccacattccgaaagccagaactgtggtcagatagcttcatggat
tttgtgaagcagtgtctcataaagagccctgagcagagagccacggccactcaactccta
cagcacccatttgtcaagagtgccaaaggagtgtccatactgcgggatttaattaacgaa
gccatggacgtgaagctgaaacgccaggaagcccagcagcgggaggtagaccaggacgat
gaagaaaactcagaggaggatgaaatggattctggcacgatggtccgagcagcgggggac
gagatgggcaccgtccgagtagccagcaccatgagtgatggcgccaatactatgatcgaa
catgatgacacgttgccatctcagctgggcaccatggtgatcaactcagaggaggaggaa
gaggaaggcactatgaaaagaagggatgagaccatgcagcctgcaagaccatctttcctt
gaatactttgaacaaaaagaaaaggaaaatcaaatcaacagctttggcaagagtgtccct
ggcccactgaagaactcttcagattggaaagttccacaggatggagactatgagttcctg
aagagttggacagtggaggaccttcagaagaggctcttggccctggaccccatgatggag
caggagatcgaagagatccggcagaagtaccagtcgaagcggcagcccatccttgacgcc
attgaggccaagaagcggcggcagcaaaacttctga

DBGET integrated database retrieval system