KEGG   Physeter catodon (sperm whale): 102989458
Entry
102989458         CDS       T06011                                 

Gene name
CASP9
Definition
(RefSeq) caspase-9 isoform X1
  KO
K04399  caspase 9 [EC:3.4.22.62]
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad01524  Platinum drug resistance
pcad04115  p53 signaling pathway
pcad04151  PI3K-Akt signaling pathway
pcad04210  Apoptosis
pcad04215  Apoptosis - multiple species
pcad04370  VEGF signaling pathway
pcad04919  Thyroid hormone signaling pathway
pcad05010  Alzheimer disease
pcad05012  Parkinson disease
pcad05014  Amyotrophic lateral sclerosis
pcad05016  Huntington disease
pcad05020  Prion disease
pcad05022  Pathways of neurodegeneration - multiple diseases
pcad05134  Legionellosis
pcad05145  Toxoplasmosis
pcad05152  Tuberculosis
pcad05160  Hepatitis C
pcad05161  Hepatitis B
pcad05162  Measles
pcad05163  Human cytomegalovirus infection
pcad05164  Influenza A
pcad05167  Kaposi sarcoma-associated herpesvirus infection
pcad05168  Herpes simplex virus 1 infection
pcad05169  Epstein-Barr virus infection
pcad05170  Human immunodeficiency virus 1 infection
pcad05200  Pathways in cancer
pcad05210  Colorectal cancer
pcad05212  Pancreatic cancer
pcad05213  Endometrial cancer
pcad05215  Prostate cancer
pcad05222  Small cell lung cancer
pcad05223  Non-small cell lung cancer
pcad05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    102989458 (CASP9)
   04151 PI3K-Akt signaling pathway
    102989458 (CASP9)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102989458 (CASP9)
   04215 Apoptosis - multiple species
    102989458 (CASP9)
   04115 p53 signaling pathway
    102989458 (CASP9)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    102989458 (CASP9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102989458 (CASP9)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102989458 (CASP9)
   05212 Pancreatic cancer
    102989458 (CASP9)
   05215 Prostate cancer
    102989458 (CASP9)
   05213 Endometrial cancer
    102989458 (CASP9)
   05222 Small cell lung cancer
    102989458 (CASP9)
   05223 Non-small cell lung cancer
    102989458 (CASP9)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102989458 (CASP9)
   05012 Parkinson disease
    102989458 (CASP9)
   05014 Amyotrophic lateral sclerosis
    102989458 (CASP9)
   05016 Huntington disease
    102989458 (CASP9)
   05020 Prion disease
    102989458 (CASP9)
   05022 Pathways of neurodegeneration - multiple diseases
    102989458 (CASP9)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    102989458 (CASP9)
  09171 Infectious disease: bacterial
   05134 Legionellosis
    102989458 (CASP9)
   05152 Tuberculosis
    102989458 (CASP9)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102989458 (CASP9)
   05161 Hepatitis B
    102989458 (CASP9)
   05160 Hepatitis C
    102989458 (CASP9)
   05164 Influenza A
    102989458 (CASP9)
   05162 Measles
    102989458 (CASP9)
   05168 Herpes simplex virus 1 infection
    102989458 (CASP9)
   05163 Human cytomegalovirus infection
    102989458 (CASP9)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102989458 (CASP9)
   05169 Epstein-Barr virus infection
    102989458 (CASP9)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102989458 (CASP9)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    102989458 (CASP9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pcad01009]
    102989458 (CASP9)
   01002 Peptidases and inhibitors [BR:pcad01002]
    102989458 (CASP9)
Enzymes [BR:pcad01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.62  caspase-9
     102989458 (CASP9)
Protein phosphatases and associated proteins [BR:pcad01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     102989458 (CASP9)
Peptidases and inhibitors [BR:pcad01002]
 Cysteine peptidases
  Family C14: caspase family
   102989458 (CASP9)
SSDB
Motif
Pfam: Peptidase_C14 CARD CARD_2
Other DBs
NCBI-GeneID: 102989458
NCBI-ProteinID: XP_007128390
UniProt: A0A2Y9FRY4
LinkDB
Position
Unknown
AA seq 452 aa
MDEADRRVLRQCRVRLVSELQVAALWDNLLNRELFTPDMIEDIQRAGSGSRRDQARQLII
DLETRGSQALPLFISCLEDTGQDTLASLLRTSRQAAKQDPEAIRPLDLKPVVLGPVSLKP
KELRGAKRDPSKPSQGKLAPVVLGPEELWPAKLSPEVLRPEAPRPVDIGSGGFSEIRAQD
RAKGNADLAYVLNADPCGHCLIINNVNFCHESGLRTRTGSSIDCERMQQRFHLLHFVVEV
KCNLTAKQMVQALVQLAQRDHSALDCCVVVILSHGCQASHLQFPGAVYGIDGYPVSVERI
VNTFNGTGCPSLGGKPKLFFIQACGGEQKDQGFEVASTSPEDRTPDSDSEPDATPFQEGP
VTVDQPDAVSSLPTPSDILVSYSTFPGFVSWRDTKSGSWYIETLDSIFEQWAHCEDLQTL
LLRVANAVSVKGIYKQIPGCFNFLRKKLFFKT
NT seq 1359 nt   +upstreamnt  +downstreamnt
atggacgaagctgaccggcgggtcctgcggcagtgccgggtgcggctggtcagcgagctg
caggtggccgcgctctgggacaatctgctgaatcgcgagctcttcacccccgacatgatc
gaggacatccagcgggcaggctctgggtctcggcgagatcaggccaggcagctgatcata
gatctagagacccgagggagtcaggcccttcctttgttcatctcctgcttagaggacaca
ggccaggacactctggcttcgttactgagaaccagtagacaagcagcaaagcaggatcca
gaggccatcagacccctggacctcaagcctgtggtgctcggaccagtgagcctcaaacca
aaggagctgagaggggcaaagcgggatccatcgaagccgagccaaggaaaactcgctcca
gtggtgctggggcctgaggagctctggccagccaagctcagccccgaggttctcagacca
gaggcacccaggccagtggacattggttctggaggattcagtgaaatccgtgctcaggac
agagccaagggaaatgccgacttggcatacgttctgaacgcagacccctgtggacactgc
ctcattatcaacaatgtgaacttctgccacgagtcggggctcaggacccgcacgggctcc
agtattgactgtgagaggatgcagcaacgcttccacttgctgcatttcgtggtggaggtg
aagtgtaacctgactgccaagcaaatggtccaggctttggtgcagctggcgcaacgggac
cacagtgctctggactgctgcgtggtggtcatcctctctcatggctgtcaggctagccac
ctccagttcccgggcgctgtttatggcatagatggatatcccgtgtctgtcgagagaatc
gtgaacacctttaacggaactggctgccccagcttgggagggaagcccaagctcttcttc
atccaggcctgtggcggagagcagaaagaccaggggtttgaggtggcctccacttcccct
gaagacaggacccctgacagcgactctgagccagatgctaccccgttccaggaaggccca
gtcaccgtcgaccagccggatgccgtgtctagtttgcccacacctagcgacatcttggtg
tcctactccaccttcccaggttttgtctcctggagggataccaagagtggctcctggtac
atcgagaccctggacagcatttttgagcagtgggctcactgcgaggaccttcagaccctc
ttgctcagggttgctaatgctgtttcagtgaaaggcatttacaaacagattcctggctgt
tttaatttcctccggaaaaaacttttctttaaaacgtaa

DBGET integrated database retrieval system