KEGG   Physeter catodon (sperm whale): 114485485
Entry
114485485         CDS       T06011                                 

Definition
(RefSeq) NF-kappa-B essential modulator-like isoform X1
  KO
K07210  inhibitor of nuclear factor kappa-B kinase subunit gamma
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad01523  Antifolate resistance
pcad04010  MAPK signaling pathway
pcad04014  Ras signaling pathway
pcad04062  Chemokine signaling pathway
pcad04064  NF-kappa B signaling pathway
pcad04151  PI3K-Akt signaling pathway
pcad04210  Apoptosis
pcad04380  Osteoclast differentiation
pcad04620  Toll-like receptor signaling pathway
pcad04621  NOD-like receptor signaling pathway
pcad04622  RIG-I-like receptor signaling pathway
pcad04623  Cytosolic DNA-sensing pathway
pcad04625  C-type lectin receptor signaling pathway
pcad04657  IL-17 signaling pathway
pcad04658  Th1 and Th2 cell differentiation
pcad04659  Th17 cell differentiation
pcad04660  T cell receptor signaling pathway
pcad04662  B cell receptor signaling pathway
pcad04668  TNF signaling pathway
pcad04920  Adipocytokine signaling pathway
pcad05132  Salmonella infection
pcad05135  Yersinia infection
pcad05142  Chagas disease
pcad05145  Toxoplasmosis
pcad05160  Hepatitis C
pcad05161  Hepatitis B
pcad05162  Measles
pcad05163  Human cytomegalovirus infection
pcad05164  Influenza A
pcad05165  Human papillomavirus infection
pcad05166  Human T-cell leukemia virus 1 infection
pcad05167  Kaposi sarcoma-associated herpesvirus infection
pcad05168  Herpes simplex virus 1 infection
pcad05169  Epstein-Barr virus infection
pcad05170  Human immunodeficiency virus 1 infection
pcad05200  Pathways in cancer
pcad05203  Viral carcinogenesis
pcad05212  Pancreatic cancer
pcad05215  Prostate cancer
pcad05220  Chronic myeloid leukemia
pcad05221  Acute myeloid leukemia
pcad05222  Small cell lung cancer
pcad05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
pcad05340  Primary immunodeficiency
pcad05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    114485485
   04014 Ras signaling pathway
    114485485
   04064 NF-kappa B signaling pathway
    114485485
   04668 TNF signaling pathway
    114485485
   04151 PI3K-Akt signaling pathway
    114485485
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    114485485
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    114485485
   04621 NOD-like receptor signaling pathway
    114485485
   04622 RIG-I-like receptor signaling pathway
    114485485
   04623 Cytosolic DNA-sensing pathway
    114485485
   04625 C-type lectin receptor signaling pathway
    114485485
   04660 T cell receptor signaling pathway
    114485485
   04658 Th1 and Th2 cell differentiation
    114485485
   04659 Th17 cell differentiation
    114485485
   04657 IL-17 signaling pathway
    114485485
   04662 B cell receptor signaling pathway
    114485485
   04062 Chemokine signaling pathway
    114485485
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    114485485
  09158 Development and regeneration
   04380 Osteoclast differentiation
    114485485
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    114485485
   05203 Viral carcinogenesis
    114485485
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    114485485
  09162 Cancer: specific types
   05212 Pancreatic cancer
    114485485
   05221 Acute myeloid leukemia
    114485485
   05220 Chronic myeloid leukemia
    114485485
   05215 Prostate cancer
    114485485
   05222 Small cell lung cancer
    114485485
  09163 Immune disease
   05340 Primary immunodeficiency
    114485485
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    114485485
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    114485485
   05135 Yersinia infection
    114485485
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    114485485
   05170 Human immunodeficiency virus 1 infection
    114485485
   05162 Measles
    114485485
   05164 Influenza A
    114485485
   05161 Hepatitis B
    114485485
   05160 Hepatitis C
    114485485
   05168 Herpes simplex virus 1 infection
    114485485
   05163 Human cytomegalovirus infection
    114485485
   05167 Kaposi sarcoma-associated herpesvirus infection
    114485485
   05169 Epstein-Barr virus infection
    114485485
   05165 Human papillomavirus infection
    114485485
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    114485485
   05142 Chagas disease
    114485485
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    114485485
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pcad01001]
    114485485
Protein kinases [BR:pcad01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   114485485
SSDB
Motif
Pfam: NEMO DUF1636 ZapB FUSC-like Bacillus_HBL RasGAP_C
Other DBs
NCBI-GeneID: 114485485
NCBI-ProteinID: XP_028342777
UniProt: A0A455B1Y5
LinkDB
Position
Unknown
AA seq 298 aa
MPPTERQGGMRVATHITGERPEGQRRLAGSGFGLRQPPSHLSPAGWGRGLSVLLPDPTAT
TPEAGSGSLAVGEGKGYRGTRVFSEHRGPRSARGRHSRLSHVGPTLLTGVVLFSEDRVPS
TLTCWMSRPPWKSPLCEMVQPSGGPAGDQGALGEESSLGKPAMLHLPSEQGAPETFQRCL
EENQELRDAIRQSNQMLRERCEELQRFQGSQREEKAFLMQKFQEARDLVERLSLEKRELH
RQREQALQELECLKTCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKERQALEGR
NT seq 897 nt   +upstreamnt  +downstreamnt
atgccgccgacggagagacaagggggaatgcgggtcgcgacgcatattactggggaacgt
cctgagggccagcggaggctggcgggctcgggtttcggtctgaggcagcctccctcacac
ctctcgccagccggctggggtcggggcctgagtgttttacttccggatcccacagctacg
acaccggaagccggaagtgggagtttggcagtgggagaagggaagggctaccgcggaacc
cgggttttttcggagcatcggggtccgaggagcgctcggggccgccactcccgcctttct
cacgtcggaccgactctgctgacaggtgtggtcctcttctccgaagacagggtaccatcg
accctgacgtgttggatgagcaggcccccctggaagagtccactgtgtgagatggtgcag
cctagcggcggcccagcaggggaccagggcgcactgggtgaagagtcttctctggggaag
ccagccatgcttcacctgccttcagagcagggtgctcctgagaccttccagcgctgtctg
gaggagaatcaagagctccgagacgccatccgccagagcaaccagatgctgcgggaacgc
tgcgaggagctgcagcgtttccagggcagccagagggaggagaaggccttcctcatgcag
aagttccaggaggcccgggacctggtggagaggctgagcctggagaagcgggagctgcac
cggcagagggagcaggccctgcaggagctggagtgcctcaagacatgccagcagcagatg
gccgaggacaaggcctcagtgaaagcccaggtgacgtccttgctgggggagctgcaggag
agccagagtcgcttggaggccgccaccaaggagaggcaggctttggagggcaggtga

DBGET integrated database retrieval system