KEGG   Phascolarctos cinereus (koala): 110200954
Entry
110200954         CDS       T05867                                 

Gene name
XIAP
Definition
(RefSeq) E3 ubiquitin-protein ligase XIAP
  KO
K04725  E3 ubiquitin-protein ligase XIAP [EC:2.3.2.27]
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw01524  Platinum drug resistance
pcw04064  NF-kappa B signaling pathway
pcw04120  Ubiquitin mediated proteolysis
pcw04210  Apoptosis
pcw04215  Apoptosis - multiple species
pcw04217  Necroptosis
pcw04510  Focal adhesion
pcw04621  NOD-like receptor signaling pathway
pcw05145  Toxoplasmosis
pcw05166  Human T-cell leukemia virus 1 infection
pcw05200  Pathways in cancer
pcw05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    110200954 (XIAP)
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    110200954 (XIAP)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    110200954 (XIAP)
   04215 Apoptosis - multiple species
    110200954 (XIAP)
   04217 Necroptosis
    110200954 (XIAP)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110200954 (XIAP)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    110200954 (XIAP)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110200954 (XIAP)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    110200954 (XIAP)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110200954 (XIAP)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110200954 (XIAP)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    110200954 (XIAP)
Enzymes [BR:pcw01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     110200954 (XIAP)
Peptidases and inhibitors [BR:pcw01002]
 Peptidase inhibitors
  Family I32: IAP family
   110200954 (XIAP)
Ubiquitin system [BR:pcw04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    110200954 (XIAP)
Mitochondrial biogenesis [BR:pcw03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Retention of mitochondria
    110200954 (XIAP)
SSDB
Motif
Pfam: BIR zf-C3HC4_3 Prok-RING_4 zf-C3HC4_2
Other DBs
NCBI-GeneID: 110200954
NCBI-ProteinID: XP_020832027
UniProt: A0A6P5JF58
LinkDB
Position
Unknown
AA seq 498 aa
MSFKIFDDRKLGVPPDINMNEDFLEEKNRLRTYVNFPSTSPIAATTLARAGFLYTGEGDT
VQCFSCRAAIDRWQFGDSAVGRHRKASPNCRFINGFYLEKHTPQFPGPFIQNCQFRIETG
QRNVNHFALESIPENYGDFLLRRGQLIDMTDTIYPRNPSMCSEEARLKSFQNWPHYAHLT
PQELASAGLYYLGVEDQVQCFCCGGKLKNWEPRDRAMTEHKRHFPKCLFVMGRDVGNAPI
EMDFSCERNYQNHAHFPRNPAMAEYEARLITFATWIYSVNERQLAKAGFYALGDRDKVAC
FHCGGGLNDWKPNEDPWEQHAKWYPGCKYLLEEKGQDYVNNIHLVNPLDGTMMETTKDAS
SITKEIDDIVLQNPLVQDAIRMGFSFHEIKRIVGEKIKSSGNDYKSLEGLVADLVIAQKE
SAQEGAASAVAMQKDVSTEEQLRYLQEEKLCKICMDENIAVVFIPCGHLVTCQMCAEAIN
KCPMCCAVINLKQKIFMS
NT seq 1497 nt   +upstreamnt  +downstreamnt
atgtcttttaagatttttgatgatcgtaaacttggtgtgcctccagacatcaacatgaat
gaagattttttagaggaaaagaatagattgagaacatatgttaattttccaagtactagc
cctattgcagcaacaacactagcacgagcaggtttcctctatactggtgaaggagatact
gtacagtgcttcagctgtcgtgcagctatagatagatggcagtttggagattcagcagtt
ggaagacataggaaagcgtcccccaactgcagattcattaatggcttttatctggaaaag
catactcctcagtttccagggccctttatccaaaactgccagttcagaattgaaactggt
cagaggaatgtaaatcattttgctttggagagtatccctgagaattatggggattttctt
ttgagaagagggcagctcattgatatgacagataccatatacccaaggaacccttccatg
tgcagtgaggaagctaggctgaaatcttttcagaattggccacactatgctcaccttacc
ccacaggagttagctagtgctggcctctattacttgggtgttgaggatcaagtgcagtgc
ttctgttgtggaggcaagctaaaaaattgggagcctcgtgatcgggcaatgaccgaacac
aagaggcatttccctaagtgtctctttgttatgggacgggatgttggtaatgctccaatt
gaaatggattttagttgtgaaaggaattatcaaaaccatgcccatttcccaaggaatcca
gccatggcagaatatgaagcacgactcattacctttgcgacgtggatttactcggttaac
gagcggcagcttgcaaaagctgggttttatgctttaggtgaccgtgataaagtagcatgc
tttcattgtggaggtggacttaatgattggaaacccaacgaagacccttgggagcaacat
gctaagtggtatcccggatgtaaatatcttttggaagagaagggccaggattatgtcaac
aacattcacttagtgaatccacttgacggtactatgatggaaactaccaaggatgcttca
tcaataactaaagaaattgatgatattgtgttacaaaatcctttggtacaagatgcaatc
cgaatgggtttcagttttcatgagattaagagaattgtgggagaaaagatcaaatcatct
ggaaacgactacaaatcgcttgagggtcttgtagcagatctagtgattgctcagaaagaa
agtgcccaagaaggagcagcaagtgcagttgcaatgcagaaagacgttagtactgaagaa
cagctccggtatttgcaggaggagaagctgtgtaagatctgcatggatgagaatatcgct
gtcgttttcatcccttgtggacatctggttacttgtcagatgtgtgctgaagcaattaac
aaatgtccgatgtgttgcgctgtcattaacttgaagcagaaaattttcatgtcgtga

KEGG   Phascolarctos cinereus (koala): 110205196
Entry
110205196         CDS       T05867                                 

Gene name
BIRC7
Definition
(RefSeq) LOW QUALITY PROTEIN: baculoviral IAP repeat-containing protein 7
  KO
K16061  baculoviral IAP repeat-containing protein 7/8
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw04120  Ubiquitin mediated proteolysis
pcw04215  Apoptosis - multiple species
pcw05145  Toxoplasmosis
pcw05200  Pathways in cancer
pcw05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    110205196 (BIRC7)
 09140 Cellular Processes
  09143 Cell growth and death
   04215 Apoptosis - multiple species
    110205196 (BIRC7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110205196 (BIRC7)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    110205196 (BIRC7)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110205196 (BIRC7)
Peptidases and inhibitors [BR:pcw01002]
 Peptidase inhibitors
  Family I32: IAP family
   110205196 (BIRC7)
Ubiquitin system [BR:pcw04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    110205196 (BIRC7)
SSDB
Motif
Pfam: BIR zf-C3HC4_3 Prok-RING_4 zf-RING_5 zf-RING_UBOX zf-RING_2 zf-C3HC4 Vps39_2 DUF2039
Other DBs
NCBI-GeneID: 110205196
NCBI-ProteinID: XP_020837221
UniProt: A0A6P5JXG2
LinkDB
Position
Unknown
AA seq 473 aa
MTLGLTTVRACEVESLTQCFPEGLASRFGTVHSGFPPTSLPPYWPKAGIQTGMIEIPVFT
SQFFEEEATQLWGRQADQSIXAFEPRMGSEASRRKTFQDWPPEGPVSPQDLARAGFFYVG
PQDRVQCFCCGGMLDNWTAGDSPILEHQRLFPKCQFALSKHTGNNPDQDTSDSVDGQILS
QLQRISEEEEGEGNEATLTNRPAYPEMGVEQIRLASFHNWPSASMVCPQQLARAGFFYTG
QHDHVKCYYCDGGLRNWDRGDDPWREHAKWFPRCEFLLQSRGRDYISSIQESSGLLDSWG
HGEDPGEVNSTSSTPGSPGSRAWLAWPAWRQSTVVKSVLQMGFEQSMVERLVLSKYRLAT
PASTSVSQLVSDLIQEEERNATETRAPVLMASEPSTPRREGQPEEITETGPLSTEQQLQQ
LKEERTCKVCMYQVVSIVFVPCGHLVCSECAPNLQQCPICRAVIHGSIRTFLS
NT seq 1422 nt   +upstreamnt  +downstreamnt
atgactctgggattgaccactgtcagagcatgtgaggtggaatccctgacccagtgcttt
ccagaaggcttagccagcagatttggaacagtccacagtgggtttcctcccacttccctt
cccccatactggcccaaggcaggcatccagacaggcatgatagaaataccagttttcact
tcccaattttttgaagaggaggccacacagctctgggggagacaggcagaccagagtata
ntagcgtttgagcccagaatgggcagtgaggcaagtcgaagaaagacattccaagactgg
cctcctgagggccctgtctctccccaggacctggccagagctggattcttctatgtaggg
cctcaggacagggttcaatgtttctgctgtggtgggatgctggacaactggacagctgga
gatagccccatcctagaacaccagaggcttttccccaagtgccagtttgccctcagcaag
catactggcaataatcctgaccaggacacttctgacagtgtggatgggcaaatcttgagc
cagttgcaaagaatatcagaggaagaagaaggggaagggaatgaagctaccctgactaac
agacccgcctatccagagatgggtgtagaacagatccggctggcctcatttcacaactgg
ccctcagcttcgatggtgtgtcctcagcaactcgccagagcgggcttcttctacacaggc
cagcatgaccatgtgaagtgttactactgtgatgggggcctgaggaactgggatcgaggg
gatgacccttggagagaacatgccaagtggttccctagatgtgaatttctgcttcaatcc
agaggcagggactatatcagcagcatccaggagtcctctggcctgctggactcctggggc
catggagaagatccaggagaggtaaattccacttcttctaccccaggtagcccaggaagc
cgggcttggctagcttggccagcttggcggcaatccacagtggtaaaaagtgtgctgcag
atggggtttgagcagagcatggtggagaggttggttctgagtaaatacaggctggcaaca
ccagccagcacatcagtgtctcagctggtctctgatcttatccaagaggaagagaggaat
gcaacagagaccagagcacctgttctgatggcatctgagccaagtacacccagaagagaa
ggccaacctgaagaaatcacagagacaggacccctgagcactgagcagcagttgcagcag
ctgaaggaggaacggacctgcaaagtgtgcatgtatcaagtggtgtccattgtcttcgtt
ccctgtggccacctggtctgttcagagtgtgcgccaaacctgcagcagtgccccatctgc
agagctgtcattcatgggagcatccggactttcctgtcctag

KEGG   Phascolarctos cinereus (koala): 110215022
Entry
110215022         CDS       T05867                                 

Definition
(RefSeq) baculoviral IAP repeat-containing protein 2-like isoform X1
  KO
K16060  baculoviral IAP repeat-containing protein 2/3
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw01524  Platinum drug resistance
pcw04064  NF-kappa B signaling pathway
pcw04120  Ubiquitin mediated proteolysis
pcw04210  Apoptosis
pcw04215  Apoptosis - multiple species
pcw04217  Necroptosis
pcw04390  Hippo signaling pathway
pcw04510  Focal adhesion
pcw04621  NOD-like receptor signaling pathway
pcw04668  TNF signaling pathway
pcw05132  Salmonella infection
pcw05145  Toxoplasmosis
pcw05168  Herpes simplex virus 1 infection
pcw05200  Pathways in cancer
pcw05202  Transcriptional misregulation in cancer
pcw05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    110215022
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    110215022
   04064 NF-kappa B signaling pathway
    110215022
   04668 TNF signaling pathway
    110215022
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    110215022
   04215 Apoptosis - multiple species
    110215022
   04217 Necroptosis
    110215022
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110215022
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    110215022
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110215022
   05202 Transcriptional misregulation in cancer
    110215022
  09162 Cancer: specific types
   05222 Small cell lung cancer
    110215022
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110215022
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    110215022
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110215022
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    110215022
Peptidases and inhibitors [BR:pcw01002]
 Peptidase inhibitors
  Family I32: IAP family
   110215022
Ubiquitin system [BR:pcw04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    110215022
SSDB
Motif
Pfam: BIR CARD zf-C3HC4_3 Prok-RING_4 zf-RING_5 zf-C3HC4_2 DUF2039 TF_Otx zf-RING_UBOX
Other DBs
NCBI-GeneID: 110215022
NCBI-ProteinID: XP_020851850
UniProt: A0A6P5L0R3
LinkDB
Position
Unknown
AA seq 601 aa
MNSVEDGVLLSRLMNRDAHEMKYDLSCELYRMSTYSAFPVNVPISERSLARAGFYYTGVN
DRVKCFCCGLMLDNWKQGDNAIDKHKQLYPSCAFIQNLIAVNLGSSQSTFSSSMNNATRS
LSSSSGQSGYFGGSYCSFPLEPVNSRAAEDLSPLNTSPYSYSMSTEDARILTYQTWPLTF
LSPLDLARAGFYYIGPGDMVACFACGGKLSNWEPKDDAMSEHRRHFPNCPFLENQIQETS
RLSVSNLSMQTHAARAKTFVTWPPQIPVHPEQLASAGFYYVGRNDDVKCFCCDGGLRCWE
SGDDPWVEHAKWFPRCEYLIRMKGQEFVDQVQARYPHLLEQLLSTSDVPGDESADLPIIH
FGPGENNSEDAVMMNTPVIKAALEMGFSRSLVKQIVQSKILTTGENYKTVNEVVSDLLNA
EDEKRKEEKERQTEEMASDDLTLIRKNRMALFQHLTCVLPILDSLLTSGVINEQEHDVIK
QKTQTSLQARELIDTVLVKGNAAANIFKNCLKEIDSVLYNNLFVEKNMKYIPTEDVSGLP
MEEQLRRLQEERTCKVCMDKEVSIVFIPCGHLVVCKECAPSLRKCPICRGIIKGTVRTFL
S
NT seq 1806 nt   +upstreamnt  +downstreamnt
atgaactcagtagaggacggtgtgctgttatcacgtttgatgaacagggacgcacatgaa
atgaaatatgatttatcgtgtgaactctacagaatgtctacatactctgctttcccagtc
aatgttccaatctcagaaagaagtcttgctcgggctggattttattacactggtgtgaac
gacagagttaaatgtttctgttgtggcttaatgctggataattggaaacagggagataat
gctattgacaaacataaacagctttatcctagctgtgcctttattcagaatttaattgca
gttaatctgggatcttctcagtctacattttcttcttctatgaataatgccactcgttca
ttatcttccagttcaggacagagtggatatttcggtggttcttattgcagttttccgttg
gagcctgtgaattccagagcagctgaggacttgtcccctctgaacaccagcccctacagt
tactcaatgagtactgaagatgccagaattcttacttatcagacatggccgttgacattt
ctgtcaccattagatctggcaagagctggtttttattacataggaccgggagacatggta
gcttgctttgcttgtggtgggaaactgagtaattgggaaccaaaagatgatgccatgtca
gaacatcggagacattttcctaactgtcctttcctggaaaatcaaatccaagaaacatca
aggttgagtgtctctaatttgagcatgcaaacccatgcagcccgtgcgaaaacctttgtg
acctggccacctcaaattccagttcatccagagcagcttgcaagtgctggcttttattat
gtaggtcgaaatgatgatgtcaaatgcttttgctgtgatggtggactgaggtgttgggaa
tcaggagatgatccttgggtggaacatgccaaatggttcccaaggtgtgaatatttgata
cgaatgaaaggacaagagtttgttgatcaagttcaagccaggtaccctcatctccttgaa
cagctgttgtcaacttcagatgttccaggggatgaaagtgctgatctaccaattattcat
tttggacctggagaaaataattctgaagatgcagtcatgatgaacactccagtgattaaa
gctgctttggaaatgggcttcagtagaagtctagtaaaacagattgttcagagtaaaatc
ttaacaactggagaaaattataaaacagtcaatgaggttgtatcagatctccttaatgca
gaagatgaaaaaaggaaggaggaaaaagagagacaaactgaagaaatggcatcagatgac
ctgacattaattcggaagaatagaatggctctgtttcagcatttgacctgtgtacttcct
atcctggatagtctcttaacatcgggtgtgattaatgagcaggaacatgatgttattaaa
caaaaaacacagacgtctctacaagcaagagaactgattgataccgttttagtcaaagga
aatgctgcagcaaatatttttaaaaactgtctcaaagaaattgattctgtgttatataat
aacttatttgtggaaaagaacatgaagtatattccaacagaagatgtttcaggtcttcct
atggaagaacagcttaggaggttacaagaagaaagaacatgtaaagtttgtatggacaaa
gaagtttctattgtatttattccttgtggtcatctggtagtatgcaaagaatgtgctcct
tctctaagaaaatgccccatttgcagaggtataatcaaaggtacagttcgtacatttctt
tcatga

KEGG   Phascolarctos cinereus (koala): 110215023
Entry
110215023         CDS       T05867                                 

Definition
(RefSeq) baculoviral IAP repeat-containing protein 2-like isoform X1
  KO
K16060  baculoviral IAP repeat-containing protein 2/3
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw01524  Platinum drug resistance
pcw04064  NF-kappa B signaling pathway
pcw04120  Ubiquitin mediated proteolysis
pcw04210  Apoptosis
pcw04215  Apoptosis - multiple species
pcw04217  Necroptosis
pcw04390  Hippo signaling pathway
pcw04510  Focal adhesion
pcw04621  NOD-like receptor signaling pathway
pcw04668  TNF signaling pathway
pcw05132  Salmonella infection
pcw05145  Toxoplasmosis
pcw05168  Herpes simplex virus 1 infection
pcw05200  Pathways in cancer
pcw05202  Transcriptional misregulation in cancer
pcw05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    110215023
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    110215023
   04064 NF-kappa B signaling pathway
    110215023
   04668 TNF signaling pathway
    110215023
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    110215023
   04215 Apoptosis - multiple species
    110215023
   04217 Necroptosis
    110215023
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110215023
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    110215023
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110215023
   05202 Transcriptional misregulation in cancer
    110215023
  09162 Cancer: specific types
   05222 Small cell lung cancer
    110215023
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110215023
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    110215023
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110215023
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    110215023
Peptidases and inhibitors [BR:pcw01002]
 Peptidase inhibitors
  Family I32: IAP family
   110215023
Ubiquitin system [BR:pcw04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    110215023
SSDB
Motif
Pfam: BIR CARD zf-C3HC4_3 Prok-RING_4 zf-RING_5 DUF2039 zf-RING_UBOX
Other DBs
NCBI-GeneID: 110215023
NCBI-ProteinID: XP_020851853
UniProt: A0A6P5L502
LinkDB
Position
Unknown
AA seq 595 aa
MNTAEDSNLCELKFDFSCELYRISTFSAFPVNVPISERSLARAGFYYTGVNDRVKCFCCG
LMLDNWKQGDNAIDKHKQLYPSCDFIQNLIAVNNLGFSSQSAFSSSGMNNDTCSLSPSSK
QSGYYSGSYYSFPLEPVTSRVVEDLSPLNTSPYCHSMSTEEARFLTYQTWPLTFMSPSDL
AKAGFYYIGPGDMVACFACGGKLSNWEPKDDAMSEHRRHFPNCPFLRNQIQEASRFSVSN
LSMQTHAARMKTFVTWPPQIPVHPEQLASAGFYYIGCDDDVKCFCCDGGLRCWESGDDPW
VEHAKWFPRCEYLNRMKGQQFICQIQASYPRLLEQLLSTSDTTVDESAELPIIHFGPREN
HSEDAVMMNTSVVKAALEMGFHRRLIKQTVQSKILTTGENYKTVNDLVSDLLKAEDETRE
EEKEQQAEEIESDDLSLIWKNRMGLFQHLTCVLPVLDSLLTATVISEQEYYAIKQKTQIS
LQVRMLIDIILVKGNVAANIFKKCLRDFDPVLHENLFVEKNINYIPATDVSDLSIEEQLR
RLQEERTCKVCMDKEVSVVFIPCGHLVVCKECAPSLRKCPICRSTIKGTVRTFLS
NT seq 1788 nt   +upstreamnt  +downstreamnt
atgaacacagcagaagatagcaacctatgtgaactgaaattcgacttttcttgtgaactc
tacagaatatctacattctctgctttcccagtcaatgttccaatctcagaaagaagtctt
gctcgggctggattttattacactggtgtgaacgacagagttaaatgtttctgttgtggc
ttaatgctggataattggaaacagggagacaatgctattgataaacataaacagctatat
cctagctgtgactttattcagaatttgattgcagttaacaatctaggattttcctctcag
tctgcattttcttcttcagggatgaataatgacacatgctcattatctcccagttcaaaa
cagagtggatattacagtggttcttattatagttttccactggagccagtgacttccagg
gtagttgaggatttgtctcctttgaacaccagcccctactgtcattcaatgagtactgaa
gaagctagatttcttacttaccagacatggccactgacatttatgtcaccatcagatctg
gcaaaagctggtttttactacataggaccaggagacatggtagcttgctttgcctgtggt
gggaaactaagtaattgggaaccaaaagatgatgccatgtcagaacatcggagacatttt
cctaactgtcctttcctgagaaatcaaatccaagaagcatcaaggttcagtgtttctaat
ctgagcatgcaaacccatgcagcccgtatgaaaacctttgtgacctggccacctcaaatt
ccagttcatccagagcagcttgcaagtgctggcttttattatataggttgcgatgatgat
gtcaaatgcttttgctgtgatggtggactgaggtgttgggaatcaggagatgatccttgg
gtggagcatgccaaatggtttccaaggtgtgagtacttgaacagaatgaaaggacaacag
ttcatctgtcaaattcaggccagttatccacgtcttcttgaacagctgctatctacatca
gacactacagtggatgaaagtgctgagctaccaattattcattttggaccaagagaaaac
cattcagaagatgcagtcatgatgaatacatctgtggtcaaagcagctttggaaatgggc
tttcatagaaggctaataaaacagacagttcaaagtaaaatcttaacaactggagaaaat
tacaaaacagtcaatgatcttgtatcagatttacttaaggcagaagatgaaacaagggaa
gaggagaaagaacaacaagctgaggaaatagaatcagatgacttatcattaatttggaag
aatagaatgggtctgtttcaacatttgacctgtgtgcttcctgttctggatagcctattg
actgccactgtgatcagtgaacaagaatattatgctattaaacaaaaaacacagatatct
ttgcaagtcagaatgctgattgatatcatcttagttaaaggaaatgttgcagccaacata
ttcaaaaaatgtctcagagattttgacccagtcttacatgagaatttgtttgtggaaaag
aacataaattatattccagcaacagatgtttcagacttgtcaatagaagaacagttgagg
cgattacaagaagaaagaacatgtaaagtttgtatggacaaagaagtatcagttgtcttt
attccttgtggacatctagtagtttgcaaagaatgtgcaccttctctaagaaaatgccct
atttgtagaagtacaatcaagggcacagttcgtacgtttctttcataa

DBGET integrated database retrieval system