KEGG   Phascolarctos cinereus (koala): 110206438
Entry
110206438         CDS       T05867                                 

Gene name
ALK
Definition
(RefSeq) LOW QUALITY PROTEIN: ALK tyrosine kinase receptor
  KO
K05119  anaplastic lymphoma kinase [EC:2.7.10.1]
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw05200  Pathways in cancer
pcw05223  Non-small cell lung cancer
pcw05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110206438 (ALK)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    110206438 (ALK)
  09162 Cancer: specific types
   05223 Non-small cell lung cancer
    110206438 (ALK)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pcw01001]
    110206438 (ALK)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:pcw04090]
    110206438 (ALK)
Enzymes [BR:pcw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     110206438 (ALK)
Protein kinases [BR:pcw01001]
 Receptor tyrosine kinases (RTK)
  ALK family
   110206438 (ALK)
CD molecules [BR:pcw04090]
 Proteins
  110206438 (ALK)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase MAM Gly_rich Ldl_recept_a FXa_inhibition
Other DBs
NCBI-GeneID: 110206438
NCBI-ProteinID: XP_020839426
UniProt: A0A6P5K3N3
LinkDB
Position
Unknown
AA seq 1651 aa
MGAPRMFPSAVLPPLLLVLLVTIPRSLSLDPFGFSAGSSPTTEQPQTQQQQPGQQQPQQQ
REPLSYSRLQRKSLAVDFIVPSLFRIYARDLLLLLPSVPGTSLPEARSSLALDCSPLLLL
LLRRQGATRTAALPHLPPGGRVLSKVLKGGSVXKLRRAKQLVLEVGEEAILEGCTGTSTS
PPEQAAVATAGMLEFNLTEMFSWWVRHGEGRLRIRLMPEKKDSLPGREVRLSAAIRASQP
RLLFQIIRKAPSSLESSTKVLAFTPEPFIWNLTWIMKDSPPFLSQRSRYGFECNFDFPCE
LEYSPPLQEDGNHYWSWRHITSEEASQMNLFSGGTAVIHSEDMPKGSFLLLNTSENTKHT
ILSPWMRSNSEHCTMQVSVYRDLQTSGRYMAQLLPHNEARREILLVPNPETHGWTVLHGR
IGYLQSPFRVSLEYISSANGSLSLVDSLSLKNCSEGMPPISKMALKSSFTCWNGTAIHLG
QACNFQRDCSEGEDEGELCKKLPAGFYCDFEDGDCGWIQGMAMPHTPQWQVGILEDAPFP
NYQGYAMLLNTSKASPAETVVLTSIMFPAPMKNSPCELQFSWLIHGVLEGNITLMLVENK
TGKEQSRTIWYFANSGDLGIWHRMVLPLPDVSDRFWLQIVTWWEEDSGAIIAFDNISLSL
DCYLTIHGEEIISRDDAPNSRNLFESIYKKSLQEPRLQETAHGENLNFDPTVHWLFTTCG
ASGPQGPTQTQCNNAYRNSNLSVVVGSEGALKGVQIWKVPATDTYSISGYGAAGGKGGKN
TMMRSHGVSVLGVFDLEKDDVLYILVGQQGGDACPSTNEIIQKVCIGENNVIEEEIRANQ
SVNEWAGGGGGGGGATYIFKMKNGIPVPLIIAAGGGGRAYGAKTDTFHPERLENNSSVLG
LNGISGAAGGGGGWNDNTSLLWSGKSLLEGATGGHSCPQAMKKWGWETRGGFGGGGGGCS
SGGGGGGYIGGNAAVNNDPEVDGEDGVSFISPLGILYTPALKVMEGHGEVNIKLYLNCSH
CEVDECHIDPESHKVICFCEHGTVLAEDGVSCIVSPTSEPHLPLSLILSVVTSALVAALV
LAFSGIMIVYRRKHQELQAMQMELQSPEYKLSKLRTSTIMTDYNPNYCFAGKTTSISDLK
EVPRKNISLIRGLGHGAFGEVYEGQVSGSPSDPSPLQVAVKTLPEVCSEQDELDFLMEAL
IISKFNHQNIVRCIGVSLQALPRFILLELMAGGDLKSFLRETRPRPNQPSSLAMLDLLHV
ARDIACGCQYLEENHFIHRDIAARNCLLTCPGPGRVAKIGDFGMARDIYRASYYRKGGCA
MLPVKWMPPEAFMEGIFTSKTDTWSFGVLLWEIFSLGYMPYPSKSNQEVLEFVTSGGRMD
PPKNCPGPVYRIMTQCWQHLPEDRPNFATILERIEYCTQDPDVVNTALPIEYGPVTEEEE
KVPVRPEDPDRIPPLLVSPQQEKKEDVCPPSVPPPLSTTSSGKPVKKAMALEPPVRVTRG
THVEGGHVNMAYSQSNPPTELHKGRGSRNKPTSLWNPTYGSWFTEKSATKNNPLTEKEQP
ERGKSGPEGQSTAGPPSVVPGRLPGSSLLLEPSSLTATMTEVPLFRLRHFPCGNVHYGYQ
QQGLPLEATPAAGSYGDSVPRNPSSVTQPGP
NT seq 4956 nt   +upstreamnt  +downstreamnt
atgggagcacccagaatgttcccatcggcggtgctgccacctctgctgttagtattgctg
gttacaatccctcggtcactgagcttggacccttttggcttctccgctggcagttcccca
acgacggagcaaccccagacccaacagcagcagcccggacagcagcagcctcagcagcaa
cgcgagccacttagctactcccggctccagaggaagagcctggctgtggacttcattgtg
ccctctctattcaggatctatgcccgggacctgctactgttgcttccatcggtaccgggt
accagcctacccgaggcgcgcagttctctggcgctggactgctcgcccctgctgctgctg
cttctgaggcgtcagggtgccaccaggactgctgctctgccccacctaccacccggagga
cgagtactgtccaaggttctgaagggtggctctgtgnnaaagctccgcagggccaagcag
ctggtgctggaagtgggcgaggaggcgatcctggagggctgcacgggcacctccactagt
cctccggagcaggcggctgtggccacggcaggaatgctagagttcaacctcacagagatg
ttcagttggtgggttcgccacggcgaagggcggctgcggatccgcctgatgccggagaag
aaggactctttgccaggcagagaagtaagactgtctgcagcaataagagcctcccagcct
cgtctacttttccaaatcataaggaaggctccaagctccctggaatcttctacaaaggtc
cttgctttcactcccgaaccctttatctggaacctaacatggatcatgaaagactctccc
cctttcctctctcaacgtagccgctatggttttgagtgcaactttgatttcccctgtgag
ctggagtattcaccacctctgcaggaagatggaaaccactactggtcttggcgccacatc
acttctgaggaggcttcccaaatgaacctgttcagtggtggcactgcagtgattcattct
gaggacatgccgaaaggttctttccttctcctcaatacatctgaaaacaccaaacatact
attctgagcccttggatgaggagcaacagtgaacactgcaccatgcaagtgtctgtatac
agggacctccaaacttcggggagatacatggcccaactcctaccacacaatgaagctagg
agagagatccttctggttccaaatccagagacacatggctggacagtgctccatgggaga
attggatacctacagagtcctttccgggtctccttggaatacatctcaagtgccaatggg
agcctatctctggtagattctttgtctctgaagaactgcagtgaagggatgccacctatc
tccaaaatggccctgaagagctccttcacctgctggaatggaacagccattcacctgggc
caggcttgcaactttcagagagactgctctgagggcgaagacgagggagaattgtgcaaa
aaactcccagctggattttattgtgactttgaggatggagactgtggctggattcaaggc
atggccatgccccatactccccagtggcaggttgggatcttggaggatgccccatttcca
aattaccaaggctacgcaatgctgcttaacactagcaaggctagcccagcagaaactgtg
gtactgaccagcatcatgtttcctgcaccaatgaagaactctccttgtgagctccaattc
tcatggctcatccacggagtcttggaaggaaacattaccctgatgctggtggagaacaaa
actgggaaggagcaaagccggactatctggtactttgccaacagtggagatttgggcatt
tggcatcggatggtcttacctcttcctgatgtgtcagacagattctggctccagattgtc
acatggtgggaggaagactcaggcgccatcattgcttttgacaacatctccctcagcctg
gactgctatcttacaattcatggggaggagataatatcaagggatgacgctcccaattca
agaaacctctttgagagtatctataagaagtcattacaggagccaagattgcaggagact
gcacatggggagaacctcaactttgatccaacagttcactggctgttcaccacatgtgga
gccagcgggccccagggtcctacgcagacccaatgcaacaatgcctacaggaattccaat
ctgagcgtggtagtgggcagcgagggtgccctgaagggtgttcagatctggaaagtgcca
gccaccgacacatacagcatctcaggctatggagcagctggaggtaaaggagggaagaat
actatgatgaggtcccatggtgtgtcagtcttgggagtctttgatctggagaaggatgac
gtcttatacatcttggtgggacagcaagggggagatgcctgccccagtactaatgaaatt
atccagaaggtttgcattggagagaacaatgtgatagaagaagagattcgagccaaccaa
agtgtgaatgagtgggctggaggtggaggaggtgggggtggagcgacctacatttttaag
atgaagaacggaataccagtacctctgatcattgcagccggaggtggtggaagagcctat
ggggccaaaacagatacattccatccagaaagactggaaaataactcctctgttctaggt
ctgaatggcatttctggagccgcaggtggtggaggtggctggaatgataacacttccttg
ctttggtcgggaaaatctttgctggaaggtgctacaggaggacattcctgcccccaggcc
atgaagaagtgggggtgggagacaagagggggtttcggagggggtggaggggggtgctcc
tcaggtggaggaggcggaggatacatagggggtaatgcagctgtgaacaatgaccccgaa
gtggatggggaggatggggtctccttcatcagtccattgggcatcctgtacaccccggct
ctgaaagtgatggagggccatggggaggtgaacatcaaactttacttgaactgcagccac
tgtgaggtggatgaatgccacattgacccagagagccacaaagttatctgtttctgcgag
catggcacagtgctggccgaagacggggtctcctgcatagtgtcacccacctctgagcct
cacctgcctctctctctgatactgtctgttgtgacctctgccctggtggctgccctagtc
ctggcattctctggcatcatgattgtgtaccgcaggaagcaccaggaactccaggcgatg
cagatggaactgcagagccccgagtacaaactgagcaaactgagaacctcaaccatcatg
accgactataaccccaactactgttttgctggcaaaaccacatccatcagtgacctcaag
gaggtgcctcggaaaaacatctccctcattcggggtctgggccatggtgcctttggggag
gtgtatgaaggacaagtgtctggaagccccagtgaccccagccccctgcaggtggcagtt
aagacgcttccagaggtgtgttcagaacaggatgagctggatttcctcatggaagcattg
atcattagcaaattcaaccaccagaacattgttcgctgtattggggtgagcctgcaggcc
ctgccccgatttatcctcctagagctgatggctggaggagacctcaaatccttccttcgg
gagactcgccctcgcccgaaccagccctcctccctggctatgctggacctgctgcacgtg
gctcgtgacattgcctgtggctgtcagtatctggaagaaaaccacttcattcaccgggat
attgctgctaggaactgtctcttgacctgccctggaccaggcagagtggccaaaatcgga
gactttggaatggctcgagacatctacagagcaagctactacaggaagggaggatgtgcc
atgcttccagtcaagtggatgcccccagaggccttcatggaggggatctttacatccaaa
acggatacgtggtccttcggtgtgcttctatgggaaatattctcccttggatacatgcca
tacccaagcaaaagcaatcaggaagttctggagtttgtcaccagtggaggacggatggat
ccacccaaaaattgccctgggcctgtgtaccggatcatgactcagtgctggcagcatctg
cctgaggaccggcccaattttgccaccatcttagagaggattgaatattgtacccaggat
ccagatgtggttaacactgctttgccaatagaatatggtccagtgactgaagaggaagag
aaggtgcccgtgaggccggaagatcctgatagaatacctcctcttttagtctctccacag
caagagaaaaaagaggatgtgtgtccaccatctgttccccctccactgtccaccacttcc
tctggtaagcccgtgaagaaagcaatggctctagagcctccagtccgcgtcaccagaggg
acacacgtagaaggaggacatgtcaacatggcatattctcagtctaatccgccaacagag
ctgcacaaagggcgtggatcaagaaacaaaccaaccagtctttggaaccccacatatggc
tcctggtttacagagaaatctgcaaccaaaaacaatcccctgacagagaaggaacagccc
gagaggggtaaatcagggccagaaggacaatccaccgcggggccacccagtgttgtccct
ggcaggctgccagggtcctccctgctcttggaaccatcttccctgactgccaccatgacg
gaagtgcctctatttaggctccgccacttcccttgtgggaatgtccactacggatatcag
cagcaaggcttacctttggaggccaccccagcagctggcagttatggggactccgttcct
agaaatccgagtagcgtgacccagcctggtccctga

KEGG   Phascolarctos cinereus (koala): 110218476
Entry
110218476         CDS       T05867                                 

Gene name
EML4
Definition
(RefSeq) echinoderm microtubule-associated protein-like 4 isoform X1
  KO
K15420  echinoderm microtubule-associated protein-like 4
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw05200  Pathways in cancer
pcw05223  Non-small cell lung cancer
pcw05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110218476 (EML4)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    110218476 (EML4)
  09162 Cancer: specific types
   05223 Non-small cell lung cancer
    110218476 (EML4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:pcw04812]
    110218476 (EML4)
Cytoskeleton proteins [BR:pcw04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    EMAP
     110218476 (EML4)
SSDB
Motif
Pfam: WD40 HELP
Other DBs
NCBI-GeneID: 110218476
NCBI-ProteinID: XP_020856878
UniProt: A0A6P5LG87
LinkDB
Position
Unknown
AA seq 997 aa
MEDSLPSLDSLCDTSTLMNFCTDDSISATSTSDVQDRLSALELRVQQQEDEITVLKAALA
DVLRRLTISEDNVVSVKKTASSKGPPALSISCVSNGSGRSRKTNHASPISISRKETFSSA
AKSSTEKKKEKPQGQKEKKEDSHSNDQSPHIRASPSPQPSSQPLQTHRQTQESKSSPPTK
SIKRLPTAEKSLSTWENSDDGHHKLLQPAVTPKLISKIIKNVDKHKDVVINQAKMSTREK
NSQEGEYIKMFMRGRPITMFIPSDVNSYDDIRTELPPEKLKLEWAYGYRGKDCRANVYLL
PTGEIVYFIASVVVLFNYEERTQRHYLSHTDCVKCLAVHPDKMRIATGQIAGVDKDGRPL
QPHVRVWDSVSLATLQVIGLGTFERGVGCLDFSKADSGVHLCVVDDSNDHMLTVWDWQKK
SKRAEIKTTNEVVLAVEFHPTDANTIITCGKSHIFFWTWNGNSLTRKQGIFGKYEKPKFV
QCLAFLGNGDVLTGDSGGIILIWNKTTVEPTPGKGPKGVYQIVKQIKAHDGSVFTLCQMR
NGMLLTGGGKDRKVILWDHDLNPEREIEVPEQYGAIRAVAEGKADQFLVGTSRNFILRGT
FNDGFQIEVQGHTDELWGLATHPFKDLLLTCAQDRQVCMWNSVEHRLEWTRLLDEPGHCA
DFHPSGTVVAIGTHSGRWFVLDAETRDLVSIHTDGNEQLSVMRYSKDGTFLAVGSHDNFI
YLYVVSESGRKYSRYGKCAGHSSYITHLDWSPDNKYIMSNSGDYEILYWDIPSGCKLIRN
RSDCKDIDWTTYTCVLGFQVFGVWPEGSDGTDINALVRSHNRKVIAVADDFCKVHLFQYP
CSKPKAPSHKYNGHSSHVTNVSFTHNDSHLISTGGKDMSIIQWRVVEKLSLPQNETPVDI
AITKAPISTNENVLQPNTSTPPPSSQPFSDAAENERMSDSSTPLENDLEQAEEHSEEQSE
GSSEYLAEPSCEEPSNETREEQNESPIPEDQQNSPAS
NT seq 2994 nt   +upstreamnt  +downstreamnt
atggaagacagcttgcctagtctcgattcactatgtgatacttctacacttatgaacttc
tgcactgatgatagtatctctgctacaagtacttctgatgtccaggatcgtctctctgcc
cttgagttgcgagttcagcaacaagaagatgaaatcacagttctgaaggcagctttggct
gatgtgttaaggcgtcttacaatctctgaagataatgtggtatctgtgaaaaaaacagcc
tcaagtaaaggtccgccagccctttctatttcctgtgtaagcaatggcagtggtagaagc
agaaaaacaaaccatgccagcccgatatcaatatcaagaaaagaaaccttttcatctgct
gctaaaagcagtacagaaaaaaagaaagaaaaaccacaaggacagaaagaaaaaaaagag
gattctcattctaacgatcaaagtccacacattcgagcatcaccttctccccagccctct
tcacagcctctccaaacacacagacaaactcaagaaagcaagagctctcctcccaccaaa
agcataaaacgactacctacagctgaaaaatcacttagtacatgggagaattcggatgat
ggtcatcacaaactattgcagccagctgtaacaccaaaattaatatcaaaaattattaaa
aatgtagacaagcataaagatgttgtcatcaatcaagcaaaaatgtcaactcgtgaaaaa
aacagccaagaaggagaatatatcaaaatgttcatgagaggtcggccaatcacaatgttt
attccttctgatgtcaacagctatgatgacatccgaactgaactgcctcctgagaagctt
aaactggagtgggcatatggctatcggggaaaagattgtcgagctaatgtttaccttctt
cctaccggggaaatagtatatttcatagcttcagtagtagttttgtttaattatgaggaa
agaacccagagacattacctgagtcacacagactgtgtaaaatgccttgctgtacatcct
gacaaaatgaggattgcaactggacagatagctggagtggataaagatggaaggcctcta
cagccccacgtcagagtttgggactcagtcagtctggccacactgcaagttattgggctt
ggaacttttgaacgtggagtgggttgtctggatttttcaaaagcagattcaggtgttcat
ttatgtgtagttgatgactccaatgaccacatgctgactgtgtgggactggcagaaaaaa
tcaaaaagagcagaaatcaagactacaaatgaagttgttctggctgtagaattccatcca
acagatgcaaatacaataataacatgtggcaaatctcatatctttttttggacctggaat
gggaattcactaacaagaaaacaaggaatttttggaaaatatgaaaaacccaaatttgtt
cagtgcttagctttcttggggaatggagatgttcttacaggagactcaggtggaatcatt
cttatatggaacaaaactactgtagaacccacacctgggaaaggacctaaaggtgtatat
caaatagtcaaacaaatcaaagctcatgatggcagtgtcttcacgctttgtcaaatgagg
aatgggatgctactaactggaggagggaaagacagaaaagtaattttgtgggatcatgac
ctaaatcctgaaagagaaatagaggttcctgaacagtatggagcaatccgggcagttgca
gaaggaaaggcagatcaatttttggttggcacatcgagaaattttattctacgaggaacg
tttaatgatggttttcaaatagaagtacagggtcacacagatgaactttggggtcttgct
acacatcccttcaaagacttattattgacctgtgctcaggacaggcaggtgtgcatgtgg
aactcggtggagcacagactggagtggaccagacttttggatgaaccaggacactgtgca
gacttccatccaagtggcacagttgtggccataggaacgcattcaggcaggtggtttgtc
ctggatgcagaaaccagagatctagtttcaatccatacagatggtaatgagcagctctca
gtgatgcgatactcaaaagatggcaccttccttgccgtaggatcccatgacaactttatt
tacctctatgtagtctcagaaagtggaagaaaatatagcagatacggaaaatgcgctgga
cattccagctatattacacaccttgactggtccccagacaacaaatatataatgtccaac
tcaggagactatgagatactatattgggacattccaagtggctgcaaactgatccgaaat
cgttctgactgtaaagacattgactggacaacttacacttgtgtactaggcttccaagtc
tttggagtgtggccagaaggatcagatggaacagatatcaatgctctagtgagatcccat
aaccgaaaagtgatagcagttgctgatgacttttgcaaggtccatctttttcagtatcct
tgttccaagccaaaggcaccaagtcacaagtataatggccacagcagccatgttactaat
gtcagctttactcataatgacagccacttaatttcaactggtggaaaagacatgagtatc
attcagtggagagttgtggagaagttatctttgcctcagaatgagactccagtagatatc
gctataaccaaagcacccatttctaccaatgagaatgtcctacaaccaaatacttccaca
ccacctccctcctcccagcccttcagtgatgctgctgaaaatgaaagaatgagtgattct
tcaacaccccttgagaatgacctggaacaggctgaagaacacagtgaggagcagagtgaa
ggcagcagtgaatacctggctgagcctagttgtgaagagccttccaatgagaccagggaa
gagcagaatgagtcacctattcctgaggaccagcagaattcaccagcttcttaa

DBGET integrated database retrieval system