KEGG   Phascolarctos cinereus (koala): 110218707
Entry
110218707         CDS       T05867                                 

Gene name
CDKN1B
Definition
(RefSeq) cyclin-dependent kinase inhibitor 1B isoform X1
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw01522  Endocrine resistance
pcw04012  ErbB signaling pathway
pcw04066  HIF-1 signaling pathway
pcw04068  FoxO signaling pathway
pcw04110  Cell cycle
pcw04151  PI3K-Akt signaling pathway
pcw04933  AGE-RAGE signaling pathway in diabetic complications
pcw04934  Cushing syndrome
pcw05162  Measles
pcw05165  Human papillomavirus infection
pcw05169  Epstein-Barr virus infection
pcw05200  Pathways in cancer
pcw05202  Transcriptional misregulation in cancer
pcw05203  Viral carcinogenesis
pcw05206  MicroRNAs in cancer
pcw05215  Prostate cancer
pcw05220  Chronic myeloid leukemia
pcw05222  Small cell lung cancer
pcw05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    110218707 (CDKN1B)
   04066 HIF-1 signaling pathway
    110218707 (CDKN1B)
   04068 FoxO signaling pathway
    110218707 (CDKN1B)
   04151 PI3K-Akt signaling pathway
    110218707 (CDKN1B)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    110218707 (CDKN1B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110218707 (CDKN1B)
   05202 Transcriptional misregulation in cancer
    110218707 (CDKN1B)
   05206 MicroRNAs in cancer
    110218707 (CDKN1B)
   05203 Viral carcinogenesis
    110218707 (CDKN1B)
  09162 Cancer: specific types
   05226 Gastric cancer
    110218707 (CDKN1B)
   05220 Chronic myeloid leukemia
    110218707 (CDKN1B)
   05215 Prostate cancer
    110218707 (CDKN1B)
   05222 Small cell lung cancer
    110218707 (CDKN1B)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    110218707 (CDKN1B)
   04934 Cushing syndrome
    110218707 (CDKN1B)
  09172 Infectious disease: viral
   05162 Measles
    110218707 (CDKN1B)
   05169 Epstein-Barr virus infection
    110218707 (CDKN1B)
   05165 Human papillomavirus infection
    110218707 (CDKN1B)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    110218707 (CDKN1B)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 110218707
NCBI-ProteinID: XP_020857233
LinkDB
Position
Unknown
AA seq 199 aa
MSNVRISDGSPTLERMEGRPAEYPKPSACRNLFGPVNHEDLTQDLKKHCRDIEEDCQRKW
NFDFRNHKPLEGSYEWQPVEKDSLPEFYFRPPRNPKGRCQRPGQESGDLNGVRQAGFVIA
SQGISEDTHLRDQKTEGASESQTSLADQCTETRKRPATDDVSPQNKRANITEEEVSDTSP
NASSVEQTPKKPSLRRHQT
NT seq 600 nt   +upstreamnt  +downstreamnt
atgtcaaacgtgcgtatttctgatgggagcccgaccctggagcggatggaaggcaggccg
gcggagtaccccaagccttcagcttgccgcaacctctttggcccagtgaaccatgaagat
ttaacgcaggacttaaagaagcattgcagggacatcgaggaagactgccagcgcaagtgg
aacttcgactttcggaatcacaagcccttggaggggagttatgagtggcaacctgtggag
aaagatagtttgcccgagttttatttcaggcccccgcggaaccccaaagggagatgccag
aggcccggccaggagagtggggatctaaacggagtgcgccaagcggggtttgttattgct
tctcagggaatctcagaggacacccacttaagagatcaaaagactgagggtgcatccgaa
agccagacgagtttggcagaccagtgcactgagacgaggaaacgaccagccacggatgat
gtctcacctcaaaacaaaagagccaacattactgaagaagaggtttcagacacttctccc
aatgctagttcagtggagcagacgcccaagaagcccagtctcagaagacatcaaacgtaa

DBGET integrated database retrieval system