KEGG   Phascolarctos cinereus (koala): 110221981
Entry
110221981         CDS       T05867                                 

Gene name
PDPK1
Definition
(RefSeq) 3-phosphoinositide-dependent protein kinase 1 isoform X1
  KO
K06276  3-phosphoinositide dependent protein kinase-1 [EC:2.7.11.1]
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw01524  Platinum drug resistance
pcw03320  PPAR signaling pathway
pcw04068  FoxO signaling pathway
pcw04071  Sphingolipid signaling pathway
pcw04140  Autophagy - animal
pcw04150  mTOR signaling pathway
pcw04151  PI3K-Akt signaling pathway
pcw04152  AMPK signaling pathway
pcw04210  Apoptosis
pcw04510  Focal adhesion
pcw04660  T cell receptor signaling pathway
pcw04664  Fc epsilon RI signaling pathway
pcw04722  Neurotrophin signaling pathway
pcw04910  Insulin signaling pathway
pcw04919  Thyroid hormone signaling pathway
pcw04931  Insulin resistance
pcw04960  Aldosterone-regulated sodium reabsorption
pcw05145  Toxoplasmosis
pcw05205  Proteoglycans in cancer
pcw05213  Endometrial cancer
pcw05215  Prostate cancer
pcw05223  Non-small cell lung cancer
pcw05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    110221981 (PDPK1)
   04071 Sphingolipid signaling pathway
    110221981 (PDPK1)
   04151 PI3K-Akt signaling pathway
    110221981 (PDPK1)
   04152 AMPK signaling pathway
    110221981 (PDPK1)
   04150 mTOR signaling pathway
    110221981 (PDPK1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    110221981 (PDPK1)
  09143 Cell growth and death
   04210 Apoptosis
    110221981 (PDPK1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110221981 (PDPK1)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    110221981 (PDPK1)
   04664 Fc epsilon RI signaling pathway
    110221981 (PDPK1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    110221981 (PDPK1)
   03320 PPAR signaling pathway
    110221981 (PDPK1)
   04919 Thyroid hormone signaling pathway
    110221981 (PDPK1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    110221981 (PDPK1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    110221981 (PDPK1)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    110221981 (PDPK1)
   05231 Choline metabolism in cancer
    110221981 (PDPK1)
  09162 Cancer: specific types
   05215 Prostate cancer
    110221981 (PDPK1)
   05213 Endometrial cancer
    110221981 (PDPK1)
   05223 Non-small cell lung cancer
    110221981 (PDPK1)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    110221981 (PDPK1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110221981 (PDPK1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    110221981 (PDPK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pcw01001]
    110221981 (PDPK1)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pcw04131]
    110221981 (PDPK1)
Enzymes [BR:pcw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     110221981 (PDPK1)
Protein kinases [BR:pcw01001]
 Serine/threonine kinases: AGC group
  PDK1 family
   110221981 (PDPK1)
Membrane trafficking [BR:pcw04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Acrosomal exocytosis proteins
    110221981 (PDPK1)
SSDB
Motif
Pfam: Pkinase PH_3 PK_Tyr_Ser-Thr Kinase-like Pkinase_fungal APH FTA2 Kdo
Other DBs
NCBI-GeneID: 110221981
NCBI-ProteinID: XP_020862418
UniProt: A0A6P5LYN9
LinkDB
Position
Unknown
AA seq 558 aa
MARTTSQIYDAIPIQTSVVLCSCPTPSMVRNHTDSSTPPVIVPCSSRQGSTMDGTAAEPR
SNSNSLPQHSGQQLPQPRKKRPEDFKFGKILGEGSFSTVVLARELATSREYAIKILEKRH
IIKENKVPYVTRERDVMSRLDHPFFVKLYFTFQDDEKLYFGLSYAKNGELLKYIRKIGSF
DETCTRFYTAEIVSALEYLHGKGIIHRDLKPENILLNEDMHIQITDFGTAKVLSPDSKQA
RANSFVGTAQYVSPELLTEKSACKSSDLWALGCIIYQLVAGLPPFRAGNEYLIFQKIIKL
EYDFPEKFFPKAKDLVEKLLVLDSTKRLGCEEMDGYGPLKDHSFFESITWEDLQHQTPPK
LTAYLPAMSEDDEDCYGNYDNLLSQFGCMQVSSSTSSHSLSASESSLPQRSGSNIDQYIH
DLDNNSFELDLQFSEDEKRLLLEKQASGNPWHQFVENNLILKMGPVDKRKGLFARRRQLL
LTEGPHLYYVDPVNKVLKGEIPWSQELRPEAKNFKTFFVHTPNRTYYLMDPSGNAHKWCK
KIHEVWRHRYQNHPNAAV
NT seq 1677 nt   +upstreamnt  +downstreamnt
atggccagaaccacgagccagatctatgatgctattcccatacaaactagtgtggtatta
tgttcctgtccaaccccatcaatggtgagaaaccatacagattccagcactccccctgtc
atcgttccctgtagtagtagacaggggtctaccatggatggcactgcagccgagccaagg
tctaattccaattccttaccacaacattcaggacagcagctaccacagcctcgaaagaaa
cggccagaagacttcaagtttggaaaaatccttggtgaaggatctttctcaacagttgtc
ttggcccgagaattggcaacttcaagagaatatgctattaaaatcctagagaaacggcat
atcataaaagaaaacaaggtaccatatgtaaccagagaaagagatgtaatgtcccgcctg
gatcaccctttctttgtaaaactttacttcacatttcaggacgatgaaaagctgtatttt
ggccttagttatgccaaaaatggagagctacttaaatacattcgaaagattggttctttt
gatgagacctgcaccagattttatactgctgaaattgtatctgctttagaatacttgcat
ggaaagggaattattcacagggaccttaaaccagagaacattttattaaatgaagatatg
cacattcagattacagattttggaacagcaaaagtattatctccagatagtaaacaagcc
agggctaactcatttgtaggaacagcacaatatgtttctccagagctgcttacagaaaaa
tctgcatgtaaaagttcagatctctgggctctcggatgtataatataccagcttgtagca
ggattaccaccatttagagcgggaaatgaatatcttatatttcagaagataattaaattg
gaatatgactttccagaaaaattcttccctaaggcaaaagatcttgtggaaaaactttta
gttttagattccacaaagcgattaggctgtgaagaaatggacgggtatgggccccttaaa
gatcactcattctttgaatccataacgtgggaggatctgcagcatcagacacctccaaag
ctcacagcgtacttacctgctatgtctgaagatgatgaagactgctatggaaattatgac
aatcttctaagccagtttggctgcatgcaagtttcgtcttcaacttcttcacattcattg
tctgcttcggagagtagcctgcctcaaaggtcaggcagcaatatagaccaatacattcat
gatctggacaataattcttttgagctggacttacagttttctgaagatgagaagagatta
ttattggagaagcaggccagtggaaacccatggcaccaatttgtagaaaataacttaata
ctaaaaatgggtccagtagataaacgaaagggtttatttgcacgccgtcgtcagttgctc
cttacagaaggaccacatttgtattatgtggaccctgtcaacaaagtcctgaaaggagaa
attccctggtcacaagaacttcggccagaagccaagaattttaaaaccttttttgttcac
acacctaacaggacatattacctgatggacccaagtgggaatgctcataagtggtgcaaa
aagatacatgaagtttggcggcacagataccagaaccatccgaatgctgctgtctag

DBGET integrated database retrieval system