KEGG   Pocillopora damicornis (lace coral): 113670324
Entry
113670324         CDS       T05773                                 

Definition
(RefSeq) apoptotic protease-activating factor 1-like
  KO
K02084  apoptotic protease-activating factor
Organism
pdam  Pocillopora damicornis (lace coral)
Pathway
pdam04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:pdam00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04215 Apoptosis - multiple species
    113670324
SSDB
Motif
Pfam: WD40 NB-ARC APAF1_C CARD ANAPC4_WD40 CARD_2 AAA_16 AAA_22 NACHT WD40_like AAA_33 AAA
Other DBs
NCBI-GeneID: 113670324
NCBI-ProteinID: XP_027042245
LinkDB
Position
Unknown
AA seq 1249 aa
MLEKHRHLLIKFRGEIVEDLLVDDVLPYLRSKFVLDSEDAEVIRKELTSRRQAEKLLDIL
SSKGYNTFDHFFTVLKEKYQHLAQLLSSDESSEDENGFNHVTEDIDSPLQLQMMTQDHAN
LLIANRVEIVEDLLVDDVLNFLQSKMVFDVHDTELIRAEVTSRRQAGKLLDLLETKNDAA
FYHFRKALEEPYPHLVEYLQENAAAPRKVSKAKELSERVENVLLEGGVPQRPAIFAHRGR
DIHKIHAALKSLKERDGWVILHGMAGCGKTVLASEALRSAVVLDECFPGGVHWIRIGPVD
QPKLLMHMQNLCARLDSDHNRQPPRNTEEAKDRLRVLFAHQHPRSLLILDDLWDSCDVKF
FDVRCRIIVTTRDAAITDMVGGSKAKVHISEGFTEDESLQILAEWTKQLPKKNLPAEAKE
IFKLTNGSPLAISMIGALLRDHPTRWEYYVKQLKKKNVSKLKPQFEYQYPTLTEAIRMSI
NNLPDELRDIYESFAVFHEDCKVPAQVLIILWNEEFEVVEDWMEDLVNKSLARRTVDSED
AIGTWYTVHNLQLTFLHEQATNLEALHKKLVDRYRKVYKGNFSEMKNDGYIHRNLLRHML
RAGLIEEAQQLITDLKWLAAKLDVTGPADLLNDYLAVKGHEDSKELKVINDFHHFVSVNA
HRFVEKPLPDLIQMGLSESRDSEVYKQAYDKAIQLGGDGKFYLDWSNRAEESQDTLLITV
KIHQGAVYCCSFSQDASKVVSCGADKTVKVWESQSGKELLSMMGHTDVVYCCAFSTNDVR
IVSCSADHRVKIWDSSSGKELLTFSGHNQEVFKCMFSPDDKKVVSCSADKTVKVWSCEDG
TEYVNFTGHADIVRCCCYSPDGSQIVSCSDDTLVKVWDSTSGQELFTLEGGTTSAVTFCC
FKPTSHSIVGVSDTVAKIWDSKTGEELKTLYASSTPLSLAYSQDDSILAVGLSDTTVQLW
NTVNEGSIGVYRGHSGWVHCVALSQDASKLVSSSDDETVKIWKVDNTNVQECMKLRMVFD
VMFRGDSLTIAITDTSNRLMIFEGENTKLLSQSVVNQIKITSISFNSDGNLWSEMLVWNV
QSGSLQFSCQHSSEEYVLSCDVSQDDKKLLSASVDKYAKVWDSSTGELCCSFGPHPDVVR
SASFSQDNKFICTGCDDGTVRVWNMCDGNKELAVCSKHDAWVANCWFSSNSDLLVSVSNN
IKWWKRDGTLCQQFNLKGTQAKSIYVSPDFSTFVSVDNIGTIYVLKRIT
NT seq 3750 nt   +upstreamnt  +downstreamnt
atgctagagaagcacaggcacttgttgattaagtttaggggagaaattgtggaagatttg
ttagtggacgatgtgcttccttacctgcggagcaagtttgtgttagactctgaggacgct
gaggtcattcgaaaggagcttacttcccgaaggcaagcagaaaagcttctggacattctt
tcatcgaaaggatacaacacatttgatcactttttcaccgttcttaaagagaaataccaa
catctcgcgcaacttttatcgagtgatgagagtagcgaggatgaaaacgggtttaatcat
gtcacggaagatatcgactcaccactacaattgcaaatgatgactcaggaccatgctaat
ctccttattgccaaccgagtggaaattgttgaagatctcttggttgatgatgtacttaac
tttcttcagagtaaaatggtatttgatgttcatgatactgagctaatcagagcagaagta
acatcaagaagacaggcagggaagctgctagacttgttggagactaaaaatgatgcagcc
ttttatcatttccgtaaggcattggaagaaccttatcctcacttggtggaatatttgcaa
gaaaatgctgctgctccaaggaaagtatcaaaagctaaagagttatcagagagagttgaa
aatgtccttctagagggtggtgtgcctcagcggccagcgatttttgcccacaggggaaga
gatattcacaaaattcatgcagcattaaagtccctaaaggagagagatggctgggttatt
ctgcatggaatggctggctgtggaaagactgtcttagcctctgaagctcttagaagtgct
gttgtcttggatgagtgcttcccaggtggtgttcactggatacgaataggccctgtagat
caacctaaacttctcatgcacatgcaaaatctttgtgccagacttgattctgatcataat
cgacaacctccacgaaacactgaagaagctaaggacaggttaagggtgctctttgcgcac
cagcaccctcgatcattgctaattcttgatgacctttgggattcctgcgatgtgaagttc
tttgatgtccgttgccgtatcattgttaccactcgtgatgcagctatcacagacatggtg
ggtggatcgaaagctaaagttcacattagtgagggttttacagaagatgaatcacttcaa
attttggctgagtggacaaagcagctgcccaagaaaaacctcccagctgaggcaaaagaa
atctttaaacttacaaatggttctcccttagcaataagtatgataggtgctctgcttcga
gatcatcctacgagatgggaatattatgtcaaacaactgaaaaagaagaatgtcagtaag
cttaaaccacagtttgagtatcaatatccaactttgacagaagcaattcgcatgagcatc
aataacctgcctgatgaactaagggacatttatgaaagctttgctgtgtttcatgaagat
tgtaaagttcctgcccaggtcctcattatactgtggaatgaggagtttgaagttgtggaa
gactggatggaagacttggtgaacaaatccttggcgagaagaacagtggattcagaagat
gcaattggtacatggtacactgtgcataacttgcagctaactttccttcatgaacaggcc
acaaacctggaagctctgcacaagaagctggtggatagatacagaaaggtgtataaggga
aactttagtgagatgaaaaatgatggctatattcaccggaatcttttgcgacacatgctt
agagcaggtctgatagaagaggcacagcaacttatcacagatctaaaatggctggctgct
aaactagatgtcactggaccggctgatctactgaatgactatttagcagtcaaaggacat
gaagacagcaaggaactgaaagtcatcaatgatttccaccattttgtaagtgtgaatgcc
catcgttttgtggagaaacctcttccagatttaatccagatgggtcttagtgaatccaga
gactctgaagtctataaacaggcatatgacaaagccattcagctgggaggggatggcaag
ttttatcttgattggagtaaccgtgcagaggagtctcaggatacacttctcataacagtg
aaaattcaccaaggagcagtgtactgttgcagtttttcacaggatgcgagcaaagtggtg
tcttgtggtgctgacaaaactgtaaaggtttgggagagtcaatcaggcaaagagctgctg
tccatgatgggccatactgatgtggtatactgctgtgcattctccactaatgatgtcaga
attgtttcatgttctgctgatcacagagtcaagatttgggacagcagtagcggaaaagaa
ctactgactttcagtggccacaaccaagaagtattcaagtgcatgttttcaccagatgac
aagaaagttgtttcctgctctgctgacaagactgtcaaggtgtggagttgtgaagatggc
acagaatatgtgaatttcacaggtcatgcagatattgtccgctgttgttgttattctcct
gatggttcacaaattgtgtcttgttctgatgacactcttgtgaaggtctgggattcaaca
tcaggacaagagttgtttacccttgagggaggaacaactagtgctgtgacattttgctgt
ttcaaaccgacttcacacagtatagttggtgtttcagatactgttgctaagatttgggac
tcgaaaactggtgaagaattaaagaccctttatgcatcttccacccctctttcactggca
tattcacaggatgatagtattttagcggtgggtctgtcagacacaacggtacagctgtgg
aatacagtcaatgaaggaagcataggtgtgtaccgaggtcactcaggctgggttcactgt
gttgccctgtcacaggatgccagcaagttggtttcatcctctgatgatgaaactgtcaag
atctggaaagttgacaacaccaatgttcaagagtgtatgaaactcagaatggtgtttgat
gtgatgtttagaggggattccctgactattgccattacagacacatccaacaggctgatg
atatttgaaggtgaaaacaccaaactgttgtcacaaagtgtagttaaccaaataaaaatc
acaagcattagttttaacagtgatggaaatctttggagtgaaatgttggtttggaatgta
cagagtggatctctacagttttcatgccaacacagcagtgaagagtatgttctctcctgt
gatgtttctcaagatgacaagaaattattgtcagcttcagtggataaatatgcaaaggtt
tgggattcttccaccggagagctttgttgctcttttgggccacaccctgatgttgtgagg
tctgcgtcattttcacaagacaacaagtttatctgcacaggctgcgatgatggaactgtc
agagtgtggaatatgtgtgatggtaacaaagaacttgctgtttgcagtaaacatgatgct
tgggttgccaactgttggttttcaagcaacagtgacctgttggtatctgtcagcaacaat
ataaagtggtggaaaagagatggaacactctgtcaacaatttaacctcaaaggaacccaa
gccaaaagtatctatgtctctccagacttctccacttttgtatcagtggacaacataggg
acaatttatgtactcaaaagaatcacatag

DBGET integrated database retrieval system