KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102102160
Entry
102102160         CDS       T02921                                 

Gene name
GLI1
Definition
(RefSeq) GLI family zinc finger 1
  KO
K16797  zinc finger protein GLI1
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Pathway
phi04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:phi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    102102160 (GLI1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:phi03000]
    102102160 (GLI1)
Transcription factors [BR:phi03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 GLI-like
    102102160 (GLI1)
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4 FOXP-CC
Other DBs
NCBI-GeneID: 102102160
NCBI-ProteinID: XP_005532030
LinkDB
Position
Un
AA seq 1267 aa
MFDPAGPPAAGYSEHCCLHPPHGPAPAAPGPPGLDFPVCHQPGHRGYGLAPGAELAADGS
RFSTPRGAGKLGKKRALSISPLSDSSIDLQTVIRTSPNSLVAFINSRCASAGGSYGHLSI
STISPSLGYQSPPGQQKGQGHLYTPPPQCSSHELPPRPGLLQHPPRGTLKHCQQLKLEWS
LSSPLSAKFPEERSEGDISSPASTGTQDPLLGMLDVREELEKEDGKPECEAVYETNCYWD
GCAKEFDTQEQLVHHINNEHIHGEKKEFVCHWAACSREQRPFKAQYMLVVHMRRHTGEKP
HKCTFEGCNKAYSRLENLKTHLRSHTGEKPYVCEHEGCNKAFSNASDRAKHQNRTHSNEK
PYVCKIPGCTKRYTDPSSLRKHVKTVHGPDAHVTKKHRGDVGPGRALPTPSAPPDMKQEK
DANGPSEARKDDGKLLVPELALKPQPSPGGQSSCSSDHSPLGSTTNNDSGVEMAGNAGGS
YEDLSTLEDVVPGEPMGTSGLMALHKLENLRIDKLKQLRKPAASKGLNLPPIPGAGLPGD
VPGLPVPPPASHRRIAELSAAELGLVALGERRSSGTSTVSSAYTVSRRSSLVSPYLAGPC
PGGEAGAMPGGPCPADGYDPISPDESRRSGDAGVCGGLPGVGSLTPAQRYRLKAKYAAAT
GGPPPTPLPGVEQVAAGGHGAVPGAYPAPAGPRCVANGLVRRHSSNEHPGYPGGVPAHLV
PRHGARRASDPARTVAKPPAVPRVQRFKSVGNVSVPGAGRTALQPLGGSEANLQRHGFSP
RPPSITENVFLESMGGPESGLLEMDQYLSYPEESFPCQGTGVELQGGIYGAPRTVVGTHG
DVEEGLLQPEFSLPQCQMNQRFPSLPAGNGALPAPWDGSPQGTLEMSSRQSLGAAAPAMS
GPHCPHQSVEYPHPSACGQHPKLLSSCQDAEFSGGHRFNRLQIKSEQRYPAPSPALAPCP
VAKLGGPAASPAAFGHAMELGPGGFPPAGPVPGGYMGIASPGGRRAQTPTLQTKEVMVRN
YVEAQQALMWGEQPHLKGSAAAVGPGSEPGQCQAVPYLSPRYCGYQPKPDHLQSLAEPQH
LLSPPCFNPEMIPHPPGGPKPPGHQASLSYPGSLAQPGHGYEGVDAGARRLPRLPPARLA
PEGPGNLPLYYPGQGGKGGHKLPGQGAASCGGTGHYGPEGLKGTSCYYLDSGEQVANSLD
SLDLENTHLDFAAIVEDVETPAALPGPPSPAGGLLLPSAGGANMAVGDMSSMLSTLAGES
HFLNSLS
NT seq 3804 nt   +upstreamnt  +downstreamnt
atgttcgaccccgcgggacccccggccgccggctacagcgagcactgctgcctgcaccca
ccccacggacccgcccccgccgccccgggaccaccaggacttgatttccccgtgtgccat
cagcccgggcaccgtggctatgggctggcaccaggagctgaactcgctgctgacggctcc
cggttctccacgccccgcggcgcggggaagctggggaagaagcgggcactgtccatctcc
ccgctgtccgactccagcatcgacctgcagaccgtgatccgcacctctcccaactccctc
gtggccttcatcaactcccgctgtgcctcggctgggggctcctacgggcacctctccatc
agcaccatcagcccgtccctggggtaccagagcccacctgggcagcagaagggccaaggc
cacctgtacacgccacccccacagtgcagctcccacgagctgcccccgcgcccggggctg
ctgcagcacccgccccgtgggaccctgaaacactgccagcagctgaagctggagtggagc
ctgagcagccccctgagtgccaaattcccagaggagcgatctgagggtgacatctccagc
ccagcgtccacgggcacccaggaccccttgctgggcatgctggatgttcgggaagagctg
gagaaggaggatgggaaacccgagtgtgaggctgtgtatgagaccaactgctactgggac
ggctgtgccaaggagtttgacacacaggagcagctggtgcaccacatcaacaacgagcac
atccacggggagaagaaggagtttgtgtgccactgggcagcgtgttcccgggagcagagg
cccttcaaggctcagtacatgctggtggtgcacatgcggcggcacacgggcgagaaacct
cacaagtgcacgttcgagggctgtaacaaggcctattcccgcctggagaacctcaagacc
cacctgcgctcacacacgggtgagaaaccctacgtgtgtgagcacgagggctgcaacaag
gccttttccaacgcctccgaccgcgccaagcaccaaaaccgcacccactccaacgagaag
ccgtacgtgtgcaaaattcccggctgcaccaagcgctacacggaccccagctccctgcgg
aaacacgtcaagaccgtgcacggccccgacgcccacgtcaccaaaaagcaccgaggggac
gtggggccaggccgggcactgcccacccccagtgcccccccggacatgaaacaggagaag
gacgcaaacggccccagcgaggctcggaaggacgatgggaaactcctggtgcctgagctg
gccttgaagcctcagcccagcccgggtgggcaatcctcgtgcagcagcgaccactcaccc
ctgggcagcaccaccaacaacgacagtggcgtggagatggcaggaaacgccggcggcagc
tacgaggacctgtccacgctggaggacgtggtgcccggggagcccatgggcacctcgggg
ctcatggctctccacaaactggaaaaccttcgcatcgacaaactgaagcagctgaggaaa
ccggcagcttccaagggcctgaacctgccgcccatccccggagccggcctgcccggggac
gttcccggtctcccggtgccgccgccagcctcgcaccggcgcatcgcggagctgtcggca
gcagagctgggcctggtggccctgggcgagcgccggagcagcggcaccagcaccgtcagc
tccgcctacaccgtcagccgccgctcgtcgctggtgtccccgtacctggcggggccgtgc
ccgggcggcgaggccggagcgatgcccggcgggccgtgcccggcggacggctacgatccc
atctctccggacgagtcgcggcgttccggcgacgccggtgtttgcggggggctgccgggg
gtgggcagcctcaccccggctcagcggtaccgcctcaaggccaaatacgccgcagccacg
ggcgggcccccgccgacccccctgcccggcgtggagcaggtggccgcgggtggccacggt
gccgtgcccggtgcttaccccgctcctgccggccctcgctgcgtcgccaacggcttggtg
agaaggcacagctccaacgagcaccccggctacccgggcggcgtccctgctcacctggtg
ccccggcacggcgcgcgacgggcaagcgaccccgctcggacggtggccaagcctccggca
gtgcccagggtgcagaggtttaagagcgtggggaatgtgagcgtgccaggcgcgggcagg
acagcgctgcagcccctgggcggctccgaggccaacctgcagcgccacggcttctcccca
cggccccccagcatcaccgagaatgtcttcctggagagcatggggggccccgagtccggc
ctgctggagatggatcagtacctgagctatcccgaggaaagcttcccgtgccagggcacc
ggtgtggagctccagggtggcatctacggtgctccccggaccgtggtggggacgcacggg
gacgtggaggaggggctcctgcagcccgagttctccctcccgcagtgccagatgaaccag
cgcttccccagtttgcctgccgggaacggggccctgccggcgccctgggatggatccccc
cagggcacgctggagatgagctccaggcaaagcctcggagctgcagctcccgccatgtcc
gggccacactgtccccatcaaagcgtcgagtacccccaccccagcgcctgcgggcagcat
cccaaactgctgagctcgtgccaggacgccgaattttccggggggcaccggtttaaccga
ctccagatcaaatccgagcagcgatacccagctccgagcccagcacttgctccctgcccc
gtcgccaaactgggcgggcccgcagcgtcccccgctgccttcggccacgccatggagctg
gggccgggcgggttcccccccgcgggaccggtaccgggcgggtacatgggcatcgccagc
ccgggcggccgcagagcccagacccccaccctgcagaccaaagaggtgatggtcaggaac
tacgtggaggcgcagcaggcgctgatgtggggggagcagccccacctcaaggggagcgcg
gctgccgtggggccgggcagtgagcccgggcagtgccaggccgtgccgtacctcagcccc
aggtactgcggttaccaacccaaaccggatcatctgcagagcctggcggagccccagcac
ctcctgagtcccccctgcttcaaccccgagatgatcccgcaccctccaggtggcccgaaa
ccaccgggtcaccaagccagcctgagctacccgggcagcctggcacagcccgggcacggc
tacgagggggtggacgccggtgcccggcgcctgccgcgcttgccccccgcccgcctcgcc
cccgaggggcccgggaacctccccctgtactacccgggccaggggggcaaaggtgggcac
aagctgccgggccagggggcagcgagctgcggggggaccgggcactacggcccagaggga
ctcaagggcacctcctgttactacctggactcgggcgagcaggtggccaacagcctggac
tcgctggacctggagaacacgcaccttgacttcgctgccatcgtggaggacgtggagacc
cccgcagcactgcctggaccccccagcccggccggggggctcctgctgccctcggctggg
ggggcaaacatggcagtgggggacatgagctccatgctgagcacgttggcaggggagagc
cacttcctcaactccctgtcctaa

KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102102459
Entry
102102459         CDS       T02921                                 

Gene name
GLI3
Definition
(RefSeq) GLI family zinc finger 3
  KO
K06230  zinc finger protein GLI3
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Pathway
phi04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:phi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    102102459 (GLI3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:phi03000]
    102102459 (GLI3)
Transcription factors [BR:phi03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 GLI-like
    102102459 (GLI3)
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4 FOXP-CC
Other DBs
NCBI-GeneID: 102102459
NCBI-ProteinID: XP_005529985
LinkDB
Position
Un
AA seq 1576 aa
MEAQSHSSTTTEKKKVENSIVKCSSRTDVSEKAVASSTTSNEDESPGQTYHRERRNAITM
QPQGGQGLGKISEEPSTSSEERASLIKKEIHGSISHLPEPSVPYRGTLFTMDPRNGYMDP
HYHPPHLFPAFHPPVPIDARHHEGRYHYEPSPIPPLHVPSALSSSPTYSELPFLRISPHR
NPAATSESPFSTPHPYINPYMDYIRSLHSSPSLSMISAARGLSPTDAPHAGVSPAEYYHQ
MALLAGQRSPYADIIPSAATAGAAGALHMEYLHAMDSARFPSPRLSARPSRKRTLSISPL
SDHSFDLQTMIRTSPNSLVTILNNSRSSSSASGSYGHLSASAISPALSFTYPPTPVSLQQ
MHQQIISRQQTLGSAFGHSPPLIHPAPTFPTQRPIPGIPSVLNPVQVSSGPSESTQQNKP
TSESAVSSTGDPMHNKRSKIKPDEDLPSPGAGSMQEQPEGMTLVKEEGDKDESKQEPEVV
YETNCHWEGCSREFDTQEQLVHHINNDHIHGEKKEFVCRWLDCSREQKPFKAQYMLVVHM
RRHTGEKPHKCTFEGCTKAYSRLENLKTHLRSHTGEKPYVCEHEGCNKAFSNASDRAKHQ
NRTHSNEKPYVCKIPGCTKRYTDPSSLRKHVKTVHGPEAHVTKKQRGDIHPRPPPPRDPG
SHSQTRSPGHQTQGAIGEQKDLSNTTSKREECLQVKAVKSEKPMTSQPSPGGQSTCSSEQ
SPISNYSNNGFELTLTGGGSVGDLSVIDETPIMDSTISTATTALGLQARRNMTGTKWMEQ
VKLERLKQVNGMLPRLNPVPPSKAPTLPPLIGNGTQSNSSCSVGGSMTILPNRNELSSTD
ITVLNMLNRRDSNTSTISSAYLSSRRSSGISPCFSSRRSSDASQAEGRPQNVSVADSYDP
ISTDASRRSSEASQCDDLPSLLSLTPAQQYRLKAKYAAATGGPPPTPLPNMERMSLKTRM
ALLGDCRESGVSPLPPVNVPRRCSDGGANGYSRRHFLSHEALGNGTRRASDPVRMASDNL
SVPRVQRFNSLNSFNPPALPPSMEKRNLVLQNYTRSEGGVFRSFSSPCPPSISENVALEA
ATMEAGSSLNDEDLLPDDVVQYLNSQNQGTYDHLLNNVLDSNKMHHSSVSGNNNPSNFDQ
APPLSSQQAGPEANKSDLPIQWNEVSSGSSDLSPSKLKCGQRSAVQQARAFRFYNNMMVQ
QQNLERSNMAQQNGYQNLVENNTSYSLQQNVTLGSGAGNSFSMHSNKPYSESMGRQAMMA
GVTDNSCGMAVQGQKLRISNMPVNGNQQNFSHPLASSDQTTSMANGMQDRNMMEQEYLQS
QPAGDGVHYQGVNHSGQMMLGQVSPTSQGSLYQGPQSCPLVSHTIGSQPSGLSAAKSYQS
CSNYSSNRRQNVLRNNLSQQQRQVDDGNQTYRVNTIKMEMQGQSQQFCSNMQNYSGQLYD
QTMGFSHQAMKTGSFFGSEASCLLQGTATENSSELLSPGANQVSSTVDSIDNNSLEGVQI
DFDAIIDDGDHVSLISGALSPSIIQNVSRNSSRLTTPRASLTFPAMPVSTTNMAIGDMSS
LLTSLAEESKFLAVMQ
NT seq 4731 nt   +upstreamnt  +downstreamnt
atggaggcacagtcccatagctctaccacaactgagaagaaaaaagtggagaattctatc
gtgaaatgctccagtcgaacagatgtcagtgagaaagctgttgcctccagcacaacttcc
aatgaggatgaaagtcctgggcagacctatcacagagagagaaggaacgcgatcacaatg
cagccgcagggtgggcaaggcctcggcaagatcagtgaagagccttccacgtcgagtgag
gaaagggcctcattaatcaagaaggagatccatggatctatatcgcaccttcccgaacct
tccgtaccttaccgcgggacgctctttaccatggacccccgaaacggttacatggaccct
cattaccatcctcctcacctttttccagcattccaccctcctgtaccaattgatgcgaga
catcatgagggacgctaccattacgaaccatctcccattcctcctctgcatgtgccttct
gccttatctagtagcccaacatactcagagcttccattccttagaatttccccgcaccga
aatcctgctgcaacatcagagtctcccttcagcacccctcacccatacattaacccctac
atggactacatcaggtccctgcacagcagcccgtccctctccatgatctcggcagcccgc
ggactcagcccaacagacgctccacatgctggcgtcagtccagctgaatattatcatcag
atggctctgttggcaggccagcgcagcccgtatgcagacatcattccttcagctgccact
gcaggagccgccggggctcttcatatggaatatcttcatgccatggatagtgccaggttt
ccaagtccgaggttgtcagctagaccgagccgtaagcgtacgttgtccatatcccccctg
tctgatcacagctttgaccttcagaccatgatacggacatctcctaactccttggtcacc
attctcaataattctcgtagcagttcgtcagccagtggctcttatggccacttatctgca
agtgcaataagccctgctctgagtttcacataccctcctacaccagtatccctccagcaa
atgcatcagcaaattataagtcgtcagcaaaccctaggttcagcctttggacacagccct
ccactcatccatcctgctccaacttttcctacccagagacccatccctggcatccccagt
gtcctgaaccctgtccaggtcagctctggaccttctgagtccacacagcagaataaaccc
accagtgaatctgcagtgagcagcacaggagaccccatgcacaacaagcgctccaagata
aagcctgacgaggatctcccgagcccaggagctggaagcatgcaggaacagccagaagga
atgaccttggtaaaggaggaaggggacaaagatgaaagcaaacaggagcctgaagtggtc
tatgagacaaactgccactgggaaggctgttcccgggagtttgacacgcaggaacagcta
gtgcatcatatcaacaatgaccacatacacggtgagaagaaagagtttgtgtgccgatgg
ctggactgttcccgggagcagaaacctttcaaagcccaatatatgctggtggtccacatg
aggagacatacaggggaaaagccacacaaatgcacttttgaaggttgtacaaaggcctac
tccagactagaaaacttgaaaacgcacttgagatctcacactggagagaaaccgtatgtg
tgcgaacatgaaggctgcaacaaagctttctccaatgcatctgacagggccaagcaccaa
aacaggactcattccaatgagaaaccatatgtttgcaagataccgggctgcacgaagcgc
tacacagaccccagctctctccggaagcacgtgaagaccgtgcatggcccggaggcacat
gtcaccaagaagcagcggggagacatccacccacggcctccgccaccaagagacccaggc
agccactctcagacccggtcaccaggccatcagactcagggtgcaattggtgagcagaag
gacctcagcaacactacctcaaagcgtgaagaatgcctccaagtgaaagcggtcaagtca
gaaaaaccaatgacatctcagccaagccctggtggtcagtctacatgcagcagcgaacag
tcccccatcagcaactattccaacaatgggttcgagcttactctgaccggtggtggtagt
gtaggagacctcagtgtcatcgatgaaaccccaatcatggactctaccatttccacagcc
accacagcacttggcttacaggccaggaggaatatgacagggaccaaatggatggagcaa
gtgaaattagaaaggttgaaacaagttaatggaatgcttccaagactgaaccccgttcca
ccttccaaagccccgaccttgccgcctctcataggaaatggtacccagtcaaacagcagc
tgcagtgtcggaggatccatgactattctgccaaacaggaatgaactctcaagtacagac
atcactgtgttgaacatgctgaacaggagggacagcaatactagcacaatcagttcagct
tacctgagcagccgcaggtcctctggaatctcaccttgcttctccagccggaggtccagc
gatgcctcccaggcagagggaaggccgcagaacgtgagcgttgcagactcctacgacccc
atctcgacggatgcctcccggcgctccagtgaagcgagccagtgtgatgacctgccaagt
cttctcagcctcaccccggcccagcaatacaggctgaaagctaaatatgcagcagctact
ggtggacccccaccaactccactgcctaacatggagaggatgagcctcaagacaaggatg
gcactcttgggtgactgcagggagtctggagtatctccactgcctccagtgaatgtccct
cgaagatgtagtgatggtggggcaaatggttacagcaggaggcattttctgtctcacgaa
gctttaggaaatgggacaaggagagccagtgatccagtcagaatggcctctgacaatctc
tctgtcccaagagtccagcgtttcaacagtcttaatagctttaaccctcctgctttgcct
ccatccatggaaaagcgcaaccttgttcttcagaactacacccgttctgagggtggcgtc
ttccgcagcttcagctccccctgtcctccaagcatcagcgagaacgtcgccctggaggct
gctaccatggaagcaggtagcagtctgaatgatgaggatctcctgccagatgacgtcgtc
cagtatctgaattcccagaaccagggcacgtacgaccatttgttgaacaatgtcctagac
agcaacaaaatgcatcacagctcagtttcaggaaacaacaaccccagcaactttgaccaa
gcccctccactgagcagtcagcaggcgggtcccgaggcaaataagagtgacttgcccatt
cagtggaatgaagtaagctcaggaagttctgacttatctccttcaaagctgaaatgtggt
cagcggtcagcagtgcagcaggctcgggccttcagattttataacaatatgatggttcag
cagcagaacctggagagaagcaacatggcccagcagaatggctatcagaacctggtggag
aacaacacttcctacagtttacagcaaaacgtgactcttggcagcggagctgggaattct
ttcagcatgcattccaacaagccttacagtgaaagcatgggcaggcaagcgatgatggct
ggggtgacagacaattcctgtggcatggcagtgcaagggcagaagctaagaatcagcaac
atgccagtgaatgggaaccagcaaaatttcagccatcccctggcatccagtgatcaaacc
accagtatggcaaatgggatgcaggacaggaacatgatggaacaggaatatttgcaaagc
cagccagctggagatggtgttcattaccagggagtcaatcactctggtcaaatgatgcta
gggcaggttagtcctacctcacaaggcagcctgtatcaagggccgcagagctgtccactg
gtgtctcacaccattggtagccagccttcaggcttgtcagcggccaaaagttaccagtca
tgctctaattacagcagcaacagacggcaaaacgtgttgagaaacaacctgtcccagcag
caaagacaagtagatgatggcaaccagacgtacagggtaaacaccattaagatggaaatg
caaggtcaatcacagcagttctgctctaacatgcagaattactctggtcagttatatgac
caaaccatgggctttagccaccaagctatgaaaacaggttctttctttggttcagaagcc
agctgcctgctgcaggggactgcaactgaaaactcatctgagcttctttccccgggggct
aaccaagtgtcaagcacagttgacagcattgacaacaacagtctagagggtgtgcagata
gattttgatgctatcatagatgatggggaccatgtcagcttaatttcgggagccctgagc
ccaagtatcattcaaaatgtctcccgcaattcctcacgcctcaccactccccgagcatct
cttacattcccagctatgcctgtaagcacaaccaacatggctattggggacatgagctct
ttgttgacctcacttgcagaagaaagcaagtttcttgctgttatgcaatag

KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102109885
Entry
102109885         CDS       T02921                                 

Gene name
GLI2
Definition
(RefSeq) GLI family zinc finger 2
  KO
K16798  zinc finger protein GLI2
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Pathway
phi04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:phi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    102109885 (GLI2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:phi03000]
    102109885 (GLI2)
Transcription factors [BR:phi03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 GLI-like
    102109885 (GLI2)
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 FOXP-CC zf-C2H2_4
Other DBs
NCBI-GeneID: 102109885
NCBI-ProteinID: XP_005519720
LinkDB
Position
Un
AA seq 1527 aa
METSASTAAGKKEGKGAVLEGNGFTETGKKPTPLAAAGAAVAQGVPQHIFPAFHAPLPID
MRHQEGRYHYEPHSIHAIHGPPPLSGSPVISDISLIRLSPHPAGPGESPFSPPHPYVAPH
MEHYLRSVHSSPTLSVISAARGLSPADVAHEHLKERGLFGLPPPPPGANPADYYHQMTLM
AGHPNPYGDLLMQGGGAASTAHLHDYLSPVDVSRFSSPRVTPRLSRKRALSISPLSDASI
DLQTMIRTSPNSLVAYINNSRSSSAASGSYGHLSAGTISPAFSFPHPLNPVTYQQILTQQ
RGLSSAFGHTPPLIQPSPTFPPRQHMAVISVNPSPAQSSSNSNCISDSSQSKQSSESAVS
STVNPVINKRSKVKTEVEGLPPVSPNTQEHLTDLKEDLDKDECKQEPEVIYETNCHWEGC
TKEYDTQEQLVHHINNDHIHGEKKEFVCRWQDCTREQKPFKAQYMLVVHMRRHTGEKPHK
CTFEGCSKAYSRLENLKTHLRSHTGEKPYVCEHEGCNKAFSNASDRAKHQNRTHSNEKPY
VCKIPGCTKRYTDPSSLRKHVKTVHGPDAHVTKKQRNDVHPRPPPLKENGDNEASAKQSS
KVSDESPEANSTTRGMEDCLQVKTIKTENSVMCQSSPGGQSSCSSEPSPLGSTNNNDSGV
EMNMHSGGSLGDLTALDDNAPVVDSTVSSGNSAVSLQLRKHMTTMQRLEQLKKEKLKTVK
DSCSWVSPAPQARNTKLPPISGNGSVLENSGGSSAMLPNPRIMELSVNEVTMLNQLNERR
DSTTSTVSSAYTVSRRSSGISPYFSSRRSSEASHLGHRPNNTSSADSYDPISTDASRRSS
EASQCSGMPGLLNLTPAQHYRLKAKYAAATGGPPPTPLPNMERMTLKNRISLMDGPDPTL
PSIRLPPGPRRCSDGNTYGYPSAPAFPQEVQGNCTRRASDPVRRPPGDPQALPRVHRFNS
TNSVNPFHPAHPTDRRNFGLQSYGRSDGSLPRHTYSPRPLSISENITIETMSGETDVPIG
DDDIMLPDDVVQYIKSQSNGTVAESTSMGYSNEMQNFQGSGKLQPPALPSQRRMAVAEAN
MSHLGPMMAECSMSFDTSSDMNKNNMPVQWNEVSSGTVDIMSNQSKQQFSQGNLAVVQQK
QNFSQYQNYSQQMQLPDNSMNATQQSFMQRNMGMDGQRLNCMQLRQQPMSLGPSMNPDMG
LHAGYNQPHQMLSPSAISGNPSQISPNCSNMAAKSGPHLHPQQMDMATDPSLMVRSNSER
TVLGQIMHEPSQQNYASQPSHLNFPAAQETFPQPIMTSSQPSFEPQQSVMGSAAHAYPPG
MIQPRPPPEPNLGSRPRGVRTAQQLGYMRTPHPTSAISPGQETTEAMHKRTSDMLLAPAQ
QCAEGTRDNNLMYYYGQIHMYEQNNGFDNHADCRVRQQQCTQNSKPATLPSPGTNQVSST
VDSQGLEPPQIDFDAIMDDGDHSSLMSGTLSPSILQNLSQNSSRLTTPRNSLTLPTIPAG
ISNMAIGDMSSMLTTLAEESKFLNMMS
NT seq 4584 nt   +upstreamnt  +downstreamnt
atggaaacttctgcttcaacagctgctgggaaaaaagaagggaaaggtgctgttctggag
gggaatggctttacagagacggggaagaaacccactcctttagcagcagcaggagcagca
gtggcacaaggagtgccgcagcacatttttccggccttccacgctcctttgccaattgac
atgcgccaccaggaaggacgataccattatgaacctcactctatccacgctatccatggg
cctcctcctctgagtggcagccccgtcatctccgacatctccctcatccgcctgtctccg
caccctgctgggcctggcgagtcgcccttcagcccgccacacccctacgtggcaccccac
atggagcactacctccgctctgtgcacagcagccccacgctctccgtcatctctgctgcc
aggggcctcagtcccgccgacgtggctcatgagcacctgaaggaacgaggcctcttcggg
ctgcccccgccaccaccgggggccaaccctgctgactactaccaccaaatgacgctgatg
gccggccacccaaacccctatggagacctcctcatgcagggcgggggagcagccagcaca
gcccacctccacgattacctcagccccgttgatgtgtcccggttttcaagcccgcgggtg
actccaagattaagccggaaacgagccctgtctatctccccgctctctgatgccagcatt
gatctccagacaatgatcaggacctccccaaactctcttgtggcgtatatcaacaactcc
agaagcagttcagcagcaagtggctcctacggccatttatctgccgggacgatcagtcca
gcattcagcttcccccacccgcttaaccccgtgacgtaccagcagatcctgacgcagcaa
agaggcctgagctcagcctttggacacactcctcccctgatccagccatccccaaccttc
cccccgcggcagcacatggcagtcatctctgtgaacccatcaccagcacagagcagcagc
aacagcaactgcatctccgactccagccagagcaagcagagcagtgagtcggccgtgagc
agcaccgtcaatccagtaattaacaaacgcagcaaagtcaagactgaagttgagggcttg
cccccagtgtccccaaacacacaggagcatctgacagacctgaaagaagatcttgataag
gatgaatgtaaacaggagcctgaggttatttatgagactaactgtcactgggaagggtgc
acaaaggaatatgacactcaggagcagctcgtccatcacatcaacaacgatcacatccac
ggggagaagaaggagtttgtctgccgctggcaggactgcacacgggagcagaagcccttc
aaggctcagtatatgttggtggtgcacatgcgaaggcacacgggagagaagccacacaag
tgcacgtttgagggttgttccaaagcctattcccgcctggagaatttaaagacacacctg
aggtcccacactggagaaaaaccttatgtctgtgaacacgaaggctgcaataaagccttt
tccaatgcctcggacagagccaagcaccagaacaggacacattccaatgagaaaccctac
gtctgtaaaatccctggctgcacaaagcggtacacggaccccagttccctcagaaaacac
gtgaagacggtgcacggacctgatgctcacgtcacaaagaagcagcgcaatgatgttcac
ccgaggccacctccactcaaggaaaatggggacaatgaggcaagcgccaagcagagcagc
aaggtgtcagatgagagccccgaggccaacagcaccacgaggggcatggaggactgctta
caagtcaaaacaataaaaacagagaattctgtgatgtgtcagtccagtcctggtggccag
tcgtcatgcagcagtgagccatcaccccttggcagcaccaacaacaatgacagtggagta
gaaatgaacatgcacagcgggggaagtctgggagatctgacggcgttggatgacaacgct
cctgtcgtggactcaacggtctcatctggtaactcggcagtcagcctgcagctaaggaaa
cacatgacgacgatgcaacgacttgaacagctcaagaaagagaaactcaagacagttaag
gattcctgctcatgggtgagcccagctccacaagccagaaacaccaagctgcctcccatc
tcaggaaatggttctgttctagaaaacagtggtggttcttctgctatgctgcctaacccc
agaataatggagctgtctgtcaacgaggttacaatgctgaaccaactcaacgagcgccgt
gatagtacaacaagcaccgtcagctctgcctacactgtcagccgcagatcctcagggatc
tccccgtacttctccagccgccgttccagtgaggcttcgcatctcgggcaccgccccaac
aacacaagctctgctgactcctatgacccgatttccacggatgcctcccgtcgctcgagc
gaggcaagccagtgcagcgggatgccgggtctgctgaacctcacaccagctcagcactac
aggctgaaagccaagtatgctgctgccacagggggccctcctccaactcccttgccaaac
atggagaggatgaccctgaagaacaggatctcgcttatggatggaccagaccccaccttg
ccctccatccgcctcccgccaggccccaggcgttgcagtgatggtaacacctatggctac
ccatcagctccagcatttccccaggaggtgcagggcaactgcacaagacgggcaagtgac
ccagtgaggagacctcctggagatccccaggctcttccacgagttcaccgcttcaacagc
accaacagtgtgaaccccttccatcctgcacaccccacggacaggaggaattttggtctc
cagagctacgggcgctcagacgggagcctgccccggcacacgtactcaccccggccgctg
agcatcagtgaaaacatcaccatagaaaccatgtccggagagacagacgtgcccattgga
gacgatgacattatgctgccagatgatgtggtacagtacatcaaatcccagagcaatggg
acagtggccgagagcacttccatgggctacagcaatgagatgcagaacttccaaggaagt
gggaagctgcagcctccagccttgcccagccagcgcagaatggcagtggctgaggcaaac
atgagccacttggggcccatgatggcagagtgttccatgagttttgatacttcttcagac
atgaataaaaataacatgcctgtccagtggaatgaagtcagctcgggcacagttgatatc
atgtccaatcagtcaaagcagcagttttcacaagggaacttagcggtggtccagcagaag
cagaacttcagtcagtaccagaactacagtcagcagatgcagcttccagacaacagcatg
aatgcaacacagcagagctttatgcagagaaacatgggcatggatgggcagaggctaaac
tgcatgcagctgcggcagcagcccatgagcctaggtcccagcatgaaccctgatatgggc
ttgcacgcggggtataaccaaccacatcagatgctgagccccagtgcaatcagtggcaac
ccaagtcagatctctcctaattgtagcaacatggcagcgaagtccggaccccaccttcac
cctcagcaaatggacatggcaactgacccttctttgatggtcaggagcaacagtgagcgc
acagtgctgggacagatcatgcatgaaccgagtcagcagaactacgcatctcagccaagc
cacctgaacttccctgcggctcaggagacctttcctcagcccatcatgacctccagtcag
cccagttttgagcctcagcagagcgtgatgggttcagctgcacatgcatatccacctggc
atgatccagcctcgtcctccaccggagccaaacctgggcagcagaccccgaggggtccgc
accgcccagcagctgggctacatgagaactccccatcctacgagcgccatcagccctggc
caggagacgacagaggccatgcataaaagaaccagtgacatgttgctggctccagcccag
cagtgcgcagagggcacgagggacaacaacttgatgtactattacgggcaaatccacatg
tatgagcagaacaacggcttcgataaccacgcggactgccgggtcaggcagcagcagtgc
acacaaaacagcaagccagccactctgccttccccaggaacaaaccaggtgtccagcaca
gtggactctcaaggtcttgagccaccccagatagattttgatgccatcatggatgatggg
gaccattcgagcctgatgtcaggaaccctgagccccagcatcctgcagaacctctcccag
aactcctctcgcctgacaactccacgaaactctctgacactgcccaccatacctgcaggg
ataagcaatatggcaataggtgatatgagctccatgctaaccacgctggcggaagagagt
aaatttctaaacatgatgtcgtaa

DBGET integrated database retrieval system