KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102105891
Entry
102105891         CDS       T02921                                 

Gene name
RELA
Definition
(RefSeq) RELA proto-oncogene, NF-kB subunit
  KO
K04735  transcription factor p65
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Pathway
phi04010  MAPK signaling pathway
phi04137  Mitophagy - animal
phi04210  Apoptosis
phi04218  Cellular senescence
phi04620  Toll-like receptor signaling pathway
phi04621  NOD-like receptor signaling pathway
phi04622  RIG-I-like receptor signaling pathway
phi04623  Cytosolic DNA-sensing pathway
phi04625  C-type lectin receptor signaling pathway
phi04920  Adipocytokine signaling pathway
phi05132  Salmonella infection
phi05164  Influenza A
phi05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:phi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102105891 (RELA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    102105891 (RELA)
  09143 Cell growth and death
   04210 Apoptosis
    102105891 (RELA)
   04218 Cellular senescence
    102105891 (RELA)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102105891 (RELA)
   04621 NOD-like receptor signaling pathway
    102105891 (RELA)
   04622 RIG-I-like receptor signaling pathway
    102105891 (RELA)
   04623 Cytosolic DNA-sensing pathway
    102105891 (RELA)
   04625 C-type lectin receptor signaling pathway
    102105891 (RELA)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    102105891 (RELA)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102105891 (RELA)
  09172 Infectious disease: viral
   05164 Influenza A
    102105891 (RELA)
   05168 Herpes simplex virus 1 infection
    102105891 (RELA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:phi03000]
    102105891 (RELA)
Transcription factors [BR:phi03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    102105891 (RELA)
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer
Other DBs
NCBI-GeneID: 102105891
NCBI-ProteinID: XP_005533697
LinkDB
Position
Un
AA seq 494 aa
MEEVTPPDLLPFLLQNWGAQEAGGAAPYVEILEQPKQRGMRFRYKCEGRSAGSIPGEHST
ETTKTHPTIRVNNYRGPGRVRVSLVTKDPPHRPHPHELVGKDCKDGFYEAELCPERSIHS
FQNLGIQCVKKRELEAAVAERIRTNNNPFNVPAEQRGGEYDLAAVRLCFQVWVRVPGGLR
PLPPVLSQPIYDNRAPSTAELRICRVNRNSGSCRGGDEIFLLCDKVQKEDIEVRFSAEGW
EAKGSFAQADVHRQVAIVFRTPPFRDPALRAPVTVRMELQRPSDRQRSAPVDFRYLPHQG
DLQCIEEKRKRTRETFRSFVQHSPLPAPSFSFGGPGALLGGPAPPEPEPLAEALLKLQFE
EGSPQIGGGSAAPPLDFGAILGDPPFPPLDVINASEVQRLLDPPEPPPDFGEGVPELPPP
DFGGPPMLMSYPEAIARLVQSQPPGGTPEMGLGAELGGTPELGGLGGLGGGPEDSLPSLG
ELDFSAFLSQFPSS
NT seq 1485 nt   +upstreamnt  +downstreamnt
atggaggaggtgacccccccggatcttctgcccttcctcctgcagaactggggtgctcag
gaggcggggggggcagcgccgtacgtggagatcctggagcagcccaagcagcgcgggatg
aggttccgctacaagtgcgaggggcgctcggccgggagcatccccggggagcacagcacc
gagaccaccaagacccaccccaccatccgcgtgaacaactaccggggcccggggcgggtg
cgggtgtcgctggtgaccaaggaccccccccaccgcccccacccccacgagctggtgggc
aaggactgcaaggacggcttctacgaggccgagctgtgccccgagcgcagcatccacagt
ttccagaatttgggaattcagtgcgtgaagaagcgggagctggaggcggcggtggccgag
cggatccgcaccaataacaaccccttcaacgtgccagctgagcagcgcgggggcgagtac
gacctggccgcggtcaggctctgcttccaggtgtgggtgagggtcccgggggggctgcgg
cccctcccccccgtcctgtcccagcccatctacgacaaccgtgcccccagcacggccgag
ctgcggatctgccgcgtcaaccgcaactccgggagctgccggggcggggacgagatcttc
ctgctctgtgacaaggtccagaaagaggacatcgaggttcgtttctcggccgagggttgg
gaggccaagggctcgttcgcgcaggccgacgttcaccgccaggtcgccatcgtgttccgc
acgccgcccttccgggaccccgcgctgcgcgccccggtcaccgtccgcatggagctgcag
cggccctcggaccggcagcgcagcgccccggtggacttcagatacctgccccaccagggg
gacctgcagtgcatcgaggagaagcgcaagcggacgcgggaaaccttccgctccttcgtc
cagcacagccccctgcccgctccctccttctcttttggggggccgggggcgcttttgggg
ggcccggccccccccgaaccggagcctttggccgaggcgctgctgaagctgcaatttgag
gaggggtccccccaaatcggggggggcagcgcggcccccccgttggattttggggctatt
ttgggggaccccccgttccccccgctggacgtcatcaacgcctccgaggttcagcgcctg
ctggacccccccgagccccccccggattttggggagggggttccagagctgccccccccg
gatttcgggggtccccccatgctgatgtcgtaccccgaggccatcgcccgcctggtgcag
agccagcccccgggggggacccccgaaatggggctgggggccgagctgggggggaccccc
gagctgggggggctgggggggctgggggggggtcccgaggattcgctgccctccctgggg
gagctggacttcagcgccttcctcagccagttcccctcgtcctga

DBGET integrated database retrieval system