KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM020230Help
Entry
Phum_PHUM020230   CDS       T01223                                 

Definition
(RefSeq) sucrase-isomaltase, intestinal, putative
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
phu00052  Galactose metabolism
phu00500  Starch and sucrose metabolism
phu01100  Metabolic pathways
phu04142  Lysosome
Brite
KEGG Orthology (KO) [BR:phu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    Phum_PHUM020230
   00500 Starch and sucrose metabolism
    Phum_PHUM020230
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    Phum_PHUM020230
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:phu04147]
    Phum_PHUM020230
Enzymes [BR:phu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     Phum_PHUM020230
Exosome [BR:phu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Phum_PHUM020230
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2 Trefoil
Motif
Other DBs
NCBI-GeneID: 8233836
NCBI-ProteinID: XP_002422874
VectorBase: PHUM020230
UniProt: E0V9T0
LinkDB All DBs
AA seq 882 aa AA seqDB search
MVLILWVSTLFENKSNKQNVHLSTLDRRVPEINQKLIFNSKIDQYNNNNNYISQILNECF
FTNDNEKFDCHPEPDANEKECFKRGCCWNTNAKPPIPSCYYPKSYSGYGIINITQSKIGL
TAFYSRKFPSPYSDDIKLLRLDVVYLNNNIVHIKITDANSNRYEPPYPEIPIVFKNNVKK
YSVNVVPLVNGFKVVRNNNDVLFDSENSGSFIFSDQFLQISGKINGKIYGLGEHQTSFQL
NTNWTKYTMFNHDGIPVSNTNLYGTHPFYLVLEKSGKSHGVFFHNKVILQPLPAVTFRSI
GGIFDFYFFLGPTPSDVIKQYTDIIGRPFFPPYWSLGFHLSRLGYKNTEEIRSVWNRTKL
ADIPFDVQWHDIDYMDKRNDFTYDKKNYFNLPDFVQEVHQNGMRYIPILDPGISGCEPNG
TYPPYNNGLLYDAFVKNYDGSIFIGKVWNSKCTVFPDFTSFKTTVYWSDEIKKLHDKIPF
DGLWIVNGSFNGCPNNKWEHPVYVPSVSGGKLYDKTICMSARHYAGLHYNLHNLYGLTET
IATNRGLKQLGKRPFIISRSTYPGSGQFGGHWSGDVVSDWQSMKETIPKLLSFSLFGIPM
MGADICGFNGNTTAALCQRWSQLGAFYPFSRNHNTDDAIDQDPVALGEENVKSTRKALMI
RYSLLPYLYTLFFKAHTRGETVARPLLFEFTNDPRTHDLNESFLWGCCLLVVPVLREYAT
TVTTYLPRARWYNWYTEFGIESNGTETVIFAPTDTIPLFIRGGSILPTQKPEVTTSLSRL
NDIELIVASNTSLHAYGTLFWDDGESLDTIKKFEYGLVDFILTPHNLTSNIIHWGYRLIP
QLGSIKILGFVKPIKSLFFNKEEVSFKWNKTSLVRKKQNILN
NT seq 2649 nt NT seq  +upstreamnt  +downstreamnt
atggttcttattctctgggtttctactctgtttgaaaataaatctaataagcaaaatgta
catttatcaactcttgacagaagagtaccagaaataaatcaaaaacttattttcaattca
aaaattgatcagtacaataataataataattatatttctcaaatcttaaacgaatgtttt
tttacaaatgataacgagaaatttgactgtcatcctgaaccggatgctaatgaaaaggaa
tgttttaaaagaggctgctgttggaatactaatgcaaagcctccaatacctagttgttat
tatcccaaatcgtacagcggttatggaattataaacattactcaatccaaaataggattg
actgctttttattcgagaaaatttccatcaccttattctgatgatattaaattgttgaga
ttagatgttgtttacttaaataataatattgtacatattaagataactgatgcaaattca
aatcgttatgagcctccctatccagaaataccgatagtttttaaaaacaatgttaaaaaa
tattcagtaaatgttgtgcctcttgttaatggtttcaaagttgtcagaaacaataatgat
gttttattcgatagtgaaaattctggaagttttattttttccgatcaatttttacaaata
agtggaaaaataaatggtaaaatttatggtcttggagaacatcaaacttcatttcaatta
aatactaattggacaaaatatacaatgtttaatcatgatggaattccagtatcaaatact
aatttatatggaactcatccattttatttggtgcttgaaaaaagtggaaaaagtcatgga
gtttttttccacaataaagtaatactacagccacttccagcagtaacatttagatctatt
ggtggtatttttgatttttatttttttctgggaccaacccctagtgatgttattaaacaa
tatacggatataattggacgtcctttttttcctccatattggtcactgggatttcatttg
tctcggttgggctacaaaaatacagaagaaattcgttctgtttggaacagaacaaaatta
gccgatataccatttgatgttcagtggcacgatattgattacatggataaaagaaatgat
tttacctacgataaaaaaaattattttaatttgcctgatttcgtacaagaggtgcatcag
aatggaatgcgttacatcccaattttagatcctgggattagtggatgcgaaccaaatggc
acataccctccatacaataacgggttactgtatgacgcttttgttaaaaactacgacgga
agcatatttatcggaaaagtttggaattccaaatgcacagtttttccagactttacctct
tttaaaacgaccgtatactggtctgatgaaataaaaaaacttcatgacaaaattcccttt
gatggactttggattgttaatggtagttttaatggttgtccaaataataaatgggaacat
ccggtttacgttcccagcgtaagcggtggtaaattatacgacaaaactatttgtatgtct
gccagacattatgccggattacattacaatcttcataatttatacggattgacggaaact
atagctacaaacagaggtcttaaacaattaggaaaacgtccatttattatttctcgttca
acatatccaggaagtggacagtttgggggtcactggagtggtgatgtcgtgtccgattgg
caatcaatgaaggaaaccattcctaaattactatctttcagcttattcggtataccgatg
atgggagccgatatatgtggattcaatggaaacacgacggcagcactttgtcaacgttgg
agtcagttgggtgctttttatccattttcaagaaatcataatacggatgatgccatcgat
caggatcccgttgctttgggagaagaaaatgtcaaatcgacgagaaaagctttaatgatt
cgttattcacttttgccttatctttacacattattttttaaagctcacactcgaggagaa
accgtggcgagacctttacttttcgagtttacaaacgatccacgcactcacgatttgaat
gaatcatttttatggggatgttgtttactcgtagttcccgttttacgagaatatgccacg
acagttacaacttacctaccacgtgcgagatggtataattggtataccgaattcggtatc
gaatctaacggaacagaaactgtgatatttgctcctacggacaccatacctctatttata
cgagggggttccattttacccactcaaaaaccggaagtcacgacttcgctcagtcgtttg
aacgatatcgaattaatagttgcgtctaatacttctttacacgcttacgggactctattt
tgggacgatggagagagtttagatacaatcaaaaaatttgaatatggattagtagatttt
attttaactcctcacaatttgacgagtaacatcatacattggggttaccgtttaattcct
cagttaggatccataaaaattcttggctttgtaaaaccgataaaaagtttattttttaat
aaggaagaagtttctttcaaatggaataaaacgagtttggtaagaaaaaaacaaaatatt
ttaaattaa

DBGET integrated database retrieval system